SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|72080862|ref|YP_287920.1| from Mycoplasma hyopneumoniae 7448

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72080862|ref|YP_287920.1|
Domain Number 1 Region: 17-425
Classification Level Classification E-value
Superfamily SIS domain 8.22e-105
Family Phosphoglucose isomerase, PGI 0.0000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|72080862|ref|YP_287920.1|
Sequence length 429
Comment glucose-6-phosphate isomerase [Mycoplasma hyopneumoniae 7448]
Sequence
MSLKLEVKTEIKLDYQGFQNQINEFHKRINDKNSPDINFLGWNNFPEVAINPQEIARMRK
IVENLHQNSINVLVVIGIGGSYLGAKAALDFILGLGPFENKPEVIFLGNSLSSTDLYQKI
EYLKTKNFAINVISKSGSTIEPAITFQILYQFLIDQIGEKLAKTRTFVTTSIKSGELLEI
AKSNELEIFEVIESIGGRFSVLSSVGFFPLLFAKINVDEIIQGAIEAHKKYSTSSISQNL
AYKYALFRFLMYKNFNYKTEILISYEPFLIYFNEWWKQLFGESEGKNLKGLFPASAIFTT
DLHSLGQFIQDGSKNFFQTIIYIKKPKFDLGIKKLVQFNSKINKLSGKTVSEINFQAFLA
TTLAHSSYGNNPNLVLEIADSSPKTFGHLVMFFEKACAMSAYLLGVNPFDQPGVESYKNE
LAKNLGWDR
Download sequence
Identical sequences Q4A7J2
WP_011290333.1.4867 gi|72080862|ref|YP_287920.1| 262722.MHP7448_0531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]