SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM435190-PA|EEB16759.1|transcription from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM435190-PA|EEB16759.1|transcription
Domain Number 1 Region: 302-359
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 5.23e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00016
Further Details:      
 
Domain Number 2 Region: 5-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000146
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00052
Further Details:      
 
Weak hits

Sequence:  vb|PHUM435190-PA|EEB16759.1|transcription
Domain Number - Region: 259-307
Classification Level Classification E-value
Superfamily ARM repeat 0.00437
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM435190-PA|EEB16759.1|transcription
Sequence length 359
Comment initiation factor IIA alpha chain TFIIA p30, putative|DS235769.1:64939:66624:1|gene:PHUM435190
Sequence
MSLSQSTVLQLYHSVIEDVVTNVRESFLDDGVDEQVLQELKQIWESKLQSTKAVELTPEP
QEPQNVGMARSGGIKLGGVKRPAGPSGDAEEHSSNQAIATDDQSIGAFRSEKLFPVQITL
PAQQGSGETGPRVLTIQVPESAITGNHLQAVLTGPLIGATLALPTALATSVLQQHVTAAL
RGQQTGSLLASRPFNVQQDNSTASQVDGTFDSNFLKSLPLADKGPAHVVVRTGLFKYSIE
TVTSSKYPESVRQVDGGIDTSDEDDDDIDDEEEEKEEEEEKDEEPENLEGAVEEEPLNSG
DDVSDEDVSDLFDTDNVVVCQFDKITRSRNKWKFYLKDGIMNLSGKDFVFQRSNGDAEW
Download sequence
Identical sequences E0VTQ3
XP_002429497.1.24195 121224.XP_002429497 vb|PHUM435190-PA|EEB16759.1|transcription

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]