SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM131590-PA|EEB11757.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM131590-PA|EEB11757.1|protein
Domain Number 1 Region: 391-627
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-28
Family Calponin-homology domain, CH-domain 0.00031
Further Details:      
 
Domain Number 2 Region: 90-243,388-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.2e-20
Family HI0933 N-terminal domain-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM131590-PA|EEB11757.1|protein
Sequence length 803
Comment MICAL-3, putative|DS235090.1:252036:256761:-1|gene:PHUM131590
Sequence
MNRKPPVSPETALASDVFDQFCAATTLKSILYHHRHLCDILKIKPTNFLQFYPKLKAKLG
SWKAQALWNKFDKRASHKCYNRGKACSQNKVLIIGAGPCGLRAAIEAQLLGARVVVLEKR
DRITRNNVLHLWPFVIQDLRGLGAKKFFGKFCAGAIDHISIRQLQFILLKVALILGVEIH
EGVAFDSLIPPPANQDTEKTGWKALVTPSDHPVSQYEFDVLIGADGKRNTLEGFKRKEFR
GKLAIAITANFINRRTEAEARVQEISGVAFIFNQKFFKDLYSDTGIDLENIVYYKDDTHY
FVMTAKKHSLIDKGVILQDYTDTARLLDPANVDKEALLKYAKEAADFSTNYLLPDLDFAV
NHHGQPDVAMFDFTSMYAAENASRIIEKNGHKLLQLLVGDSLLEPFWPTGSGCARGFLSC
MDACWVIKNWAVNGAINPLEVLAERESIYRLLGQTTPENLQKDPLTYTLDPHTRYPNLNS
RSVLPLQVRNLFETDDPASMELAIAPTTTQEVPKKKRKKDSQVHPDTLLLWIKRQVCMHP
ELHVENMTYSFKDGLILCAIISRYRPDLLDYSTLRVEETAANNQRAFDILEKELGIPPVM
TGEEMAECECPDRLTMLSYLSQVYDSFRGEIPHVAHDKRVPDSEETEDDYAIANQLKTKL
PRNSTGRKRHSGENVGRGDASLRRSRKRRSGGDKLPFNDEERQKRLEEIEQNRRDRQERR
RFLRRMQTEQFKKSLAMMECNQWVPEDEEDKEFEDYSLYVYRQTAPEFHNRVKELEMKLL
YPVRKDLASRVVTFPNFQLTISV
Download sequence
Identical sequences E0VEF1
121224.XP_002424495 XP_002424495.1.24195 vb|PHUM131590-PA|EEB11757.1|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]