SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM157900-PA|EEB12143.1|Cysteine from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM157900-PA|EEB12143.1|Cysteine
Domain Number 1 Region: 77-529
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.98e-120
Family Pyridoxal-dependent decarboxylase 0.00029
Further Details:      
 
Weak hits

Sequence:  vb|PHUM157900-PA|EEB12143.1|Cysteine
Domain Number - Region: 23-102
Classification Level Classification E-value
Superfamily Bacterial adhesins 0.000236
Family Fibrinogen-binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM157900-PA|EEB12143.1|Cysteine
Sequence length 532
Comment sulfinic acid decarboxylase, putative|DS235113.1:10115:12286:-1|gene:PHUM157900
Sequence
MFPVISTQKQSFGIINLSLLEDNNFLIKTNSVVDKSDKEDEKLNQKHWSLPLEKYHYDFI
VKCVGIIMKEAVFDGTNRNSKVVQWQDPEKLKKSFDFSLNKYSETEGKLLHLISTIIKFS
VKTGHPYFVNQLFSGVDPYGLIGQWLTDALNPSVYTYEVSPVFSIMEEVVLEEMRKFIGF
PNGKGDGTFCPGGSISNGFGISCARYHLFPQVKKLGIYGIGLRLVLFTSRDAHYSIVKLA
TFMGLGSDNVISIKTDESGKMKPEELEKAILKVLQEGGTPFMVSATSGTTVLGAFDPLDS
IADICEKYKLWFHVDAAWGGGCLMSSIHKKKLQGIHRTDSVTWNPHKLLGVPQQCSAFLT
KHKNLLKNVHCAKATYLFQKDKFYDVKYDTGDKHIQCGRRADVLKFWFMWKAKGSSGFEK
HINKIFETALYFKKSIENKPDFQLVLSEPECTNICFWYIPPRLQNSKYNNDDLNKVAPRM
KEKMMKDGSMMITYQPLRHLPNFFRLVIVNSGLDTHDMDRLITIIQNAGASI
Download sequence
Identical sequences E0VFI7
121224.XP_002424881 XP_002424881.1.24195 vb|PHUM157900-PA|EEB12143.1|Cysteine

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]