SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM177470-PA|EEB12424.1|ras from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM177470-PA|EEB12424.1|ras
Domain Number 1 Region: 936-1057,1089-1295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-53
Family p120GAP domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 23-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.81e-29
Family Calponin-homology domain, CH-domain 0.0000767
Further Details:      
 
Domain Number 3 Region: 1453-1506
Classification Level Classification E-value
Superfamily RGC domain-like 0.00000012
Family RGC domain 0.00097
Further Details:      
 
Weak hits

Sequence:  vb|PHUM177470-PA|EEB12424.1|ras
Domain Number - Region: 610-651,683-823
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000133
Family Motor proteins 0.073
Further Details:      
 
Domain Number - Region: 432-551
Classification Level Classification E-value
Superfamily V-type ATP synthase subunit C 0.0445
Family V-type ATP synthase subunit C 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM177470-PA|EEB12424.1|ras
Sequence length 1518
Comment GTP-ase activating protein with iq motif, putative|DS235135.1:75821:82612:-1|gene:PHUM177470
Sequence
MKLKEIGDKQQTLKVNNFHQNSVAYEYLCRIEEVKLWMESILNEPLPPTILIEENLRNGV
YLAKIGNFIAPERVPLSRIYDIFQHKYKSVGLQPQHAENVSYWVKALKSINLPKKFIVEA
AGIYDKKDMPQVIYCIHALSIYLFHLGQAPLIQELYGKVQFTENDIDTISFDMEKNNVSL
PEFQKINDLLAECLTNDKNTLNIEINNLNQAIIEESNEKLLSSLNLTSANLVQIIPEYIS
YYLKAFKNARNKKFQSAQNQSLNRKCKSNSYNITLSLSEIQGYIREVNIECTWRDILLSV
KKRDRHNLKKIIESFFPEIKDYQSKNLEYYINEALSIDPNIASTNKAREKIHGIVRNGNR
KFKEFSRVSDAVKKVEEAIKSNSKDNLLTALKIPCLKLSSEIINFAAPLYLEEMREDLKM
SKELTYKDIKSSIFILNNIAKITVAVDNCDYKSFWMLLWNADIPFMNIDIALKTQYFKAL
SACREQKKNQNLENTLLTFVDIQECIDMANIQTLEQTNTLIYLEEINNAVQCSNTQKLLP
ALQGVTSEEELSDDDAILCMHLLKKLMKEEEMNEDRELWLNDVISVVDEMKDLKKKALFI
CDFLRGKNLRDCLPPNTFETNQKSKNKFLTTNGYKNIEKNNSSDIWLKVKLKDEINIYLN
PSSGSIKWFPTVDFIKKLPCLIPINDIEVLFRKNYLKLIFTNGCDWKFSNFIIILQFIIR
NFESTSFKRTSLENFHFDSEILIKFQGAIRGFIIRKNIKKKLKAIILIQKWWRRIQNEKL
IEAQIGKNEKKFSSPDDFYIKHVRKIIKIQAFWRGYLTRKNFNSHNKILDSKIEPSFKYL
RRLSLLNYLNDHYDYSVELEIQKIKSSIVKIIRTNQEQAKKLEEMDIKIGLLVQNRMSVE
AIVAENKKIQNISTVGIDSRGIKAFSKEAKTLLDGYRQLFYLLQTDPVYLTRLIVRLPSK
FNHVIQSCVLSLFNYGSNTRDAYLLLRLFRLALFEEVQNKFQKPVDAITGNSLVLRLAVA
FTRQNHNPLKNILGFLIEKVLNDKVCIDTNPVDIYRRWVNQIETESGKPSNLPQTVSIEE
ALSYPEIVMRLNHNLKILQSWVKCFLDRLVQCVNQFPYALRFIAKQLKNALFQKFPKALE
KDILKIVGNLVYYQYINSAIVAPDAFCTITLPPDQPMKQEQRRNLASIAKILHFAATKKG
FGEETKYLKSLNPFIIECHEIMKQFCKNCCAVEELEKHFRIDKYSEALMINKPKIYINLE
EIRECHKLLLEVQHEIAPDSMDPIHEILDDLGSPPSLSTLVGCNDSSEATLCRAGRLQVC
LELENKFQIPPQEVTENEKLFIEQGDTLASAICVPKHFDLYSKLAKLELAGFVRSENDYI
EIIKSLLIDISYKQEFLKLQKQEIIELKSTLLRLEEKKEFYESQVSRYEQYLKTCLSNLT
VSSKRYKEKKEYSIKYSGARLREKGVLISLNGVPLTQLKNVQFEISTTKLNGIYSVHGRF
MGVEVCISKTSLNDENKN
Download sequence
Identical sequences E0VGB8
XP_002425162.1.24195 vb|PHUM177470-PA|EEB12424.1|ras 121224.XP_002425162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]