SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM227910-PA|EEB13184.1|Nesprin-1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM227910-PA|EEB13184.1|Nesprin-1
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.46e-81
Family Calponin-homology domain, CH-domain 0.000003
Further Details:      
 
Domain Number 2 Region: 7098-7259
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-31
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 6123-6283
Classification Level Classification E-value
Superfamily Spectrin repeat 4.66e-26
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 6990-7146
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-25
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 5 Region: 5694-5849
Classification Level Classification E-value
Superfamily Spectrin repeat 6.35e-24
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 6 Region: 6896-7037
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-22
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 7 Region: 7335-7474
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-22
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 7741-7865,7935-7967
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-21
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 3273-3463
Classification Level Classification E-value
Superfamily Plakin repeat 6.93e-21
Family Plakin repeat 0.007
Further Details:      
 
Domain Number 10 Region: 3961-4058
Classification Level Classification E-value
Superfamily Plakin repeat 7.85e-21
Family Plakin repeat 0.005
Further Details:      
 
Domain Number 11 Region: 6235-6391
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-21
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 12 Region: 6548-6694
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 4886-5033
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-20
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 14 Region: 7225-7333
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 4280-4317,4349-4448
Classification Level Classification E-value
Superfamily Plakin repeat 1.07e-19
Family Plakin repeat 0.0039
Further Details:      
 
Domain Number 16 Region: 3585-3652,3710-3812
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-19
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 17 Region: 246-355
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-19
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 18 Region: 641-762
Classification Level Classification E-value
Superfamily Spectrin repeat 6.79e-19
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 19 Region: 7552-7681
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-18
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 20 Region: 6662-6805
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 21 Region: 6345-6494
Classification Level Classification E-value
Superfamily Spectrin repeat 8.35e-18
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 22 Region: 8075-8161
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.83e-17
Family GAS2 domain 0.00065
Further Details:      
 
Domain Number 23 Region: 1459-1618
Classification Level Classification E-value
Superfamily Plakin repeat 2.18e-17
Family Plakin repeat 0.0073
Further Details:      
 
Domain Number 24 Region: 5417-5526
Classification Level Classification E-value
Superfamily Spectrin repeat 4.61e-17
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 25 Region: 6767-6890
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 26 Region: 3864-3983
Classification Level Classification E-value
Superfamily Plakin repeat 3.92e-16
Family Plakin repeat 0.0063
Further Details:      
 
Domain Number 27 Region: 1605-1769
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000268
Family Plakin repeat 0.0079
Further Details:      
 
Domain Number 28 Region: 2714-2863
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000314
Family Plakin repeat 0.0076
Further Details:      
 
Domain Number 29 Region: 2349-2540
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000785
Family Plakin repeat 0.0089
Further Details:      
 
Domain Number 30 Region: 5921-6061
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000804
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 31 Region: 553-681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000237
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 32 Region: 5488-5629
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000406
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 33 Region: 3477-3597
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000432
Family Plakin repeat 0.0062
Further Details:      
 
Domain Number 34 Region: 5089-5213
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000441
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 35 Region: 4159-4265
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000445
Family Plakin repeat 0.0069
Further Details:      
 
Domain Number 36 Region: 5273-5418
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000734
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 37 Region: 2840-3043
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000131
Family Plakin repeat 0.0067
Further Details:      
 
Domain Number 38 Region: 7480-7561
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000131
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 39 Region: 7985-8065
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000138
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 40 Region: 4455-4554
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000017
Family Plakin repeat 0.0048
Further Details:      
 
Domain Number 41 Region: 891-1040
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 42 Region: 1312-1424
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000314
Family Plakin repeat 0.0049
Further Details:      
 
Domain Number 43 Region: 4623-4766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000918
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 44 Region: 4778-4881
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000608
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 45 Region: 4066-4159
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000445
Family Plakin repeat 0.009
Further Details:      
 
Domain Number 46 Region: 3113-3199
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000706
Family Plakin repeat 0.0091
Further Details:      
 
Domain Number 47 Region: 366-458
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000733
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 48 Region: 473-554
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000345
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 49 Region: 4566-4636
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000843
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 50 Region: 1046-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000522
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  vb|PHUM227910-PA|EEB13184.1|Nesprin-1
Domain Number - Region: 5849-5955
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000137
Family Spectrin repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM227910-PA|EEB13184.1|Nesprin-1
Sequence length 8614
Comment putative|DS235200.1:21697:76958:1|gene:PHUM227910
Sequence
MNERDAIQKKTFTKWVNKHLKKAGRHVNDLFEDLQDGHNLISLLEVLSQETLPRERGRLR
FHMLHNVQTCLDFLRYKKIKLVNIRAEDIVDGNPKLTLGLIWTIILHFQISDIIIGQEPN
VTAKDALLRWAKKSTTKYPGVRINDFTSSWRDGLAFNAIIHRNRPDLIDWRTIRSRQIRD
RLENAFHVAEREYGVTRLLDVEDVDTNEPDEKSLITYISSLYDVFPEPPVHHPMQENESQ
SRTTGGYREMAIQMHLWIREKLSLMQDRSFPNSLPEIKRMVAESNRFRNEEIPAKQREKQ
RLHSAFRDLTKHHDSYNDFDLEPELHIDNIEKNWTRLLKAHQDKDLAIQEELKRLEKLQR
LADKVHREMKQVDTRLEELEQQIEVESTRLDRLHPVDAKNIVEQLQMNIRMVEENIQYIL
SDVQYLREARYPQAPELYKRVERLRQRWESLQNLLHSRIINQITNSSFEERTVIRQTRTV
LETRLVDSNPHFRQLQDCIDWVKNKLASINEREYGSDLPSCQAELDAVQREQKHIEQYQQ
KIQQCANSKNNFHGEEHQLYIQHLNNLQKIYAELLVLINKRMTDLETLQDFLQSATNELV
WLNEKEETEITRDWSDKNLDLSSVHHYYESLMSELERREIQFSAVVDRGEALILQRHPAS
KCIETYMTALQNQWSWVLQLALCLETHLKQAQVYQQFYKDVKEAEDWISKRDEMLNTIYS
QSDFSLDDGERLLKGMQDLREELNHYGDVVSQLAETSKDVVPLKQRRQPVTKPLKVRAIC
DYKQGNINIDKNETCVLHDNSGRVKWRVKNMANVEGVVPGVILAIPPPDKDAIEAIERLR
RQFDRSVALWQKKQLRMRQNMIFATIKVVKTWDLAQFVAMGQEQRNAIRRALNDDAEKLI
SEGDPTDPQLRRLRREMDEVNRLFDEFEKRARQDEESKNMGRIFETQISTLQISLDEAEN
ALNSRISAPVPRDLDSLEHMVIQHKDFEQRLLTLKTRVDEVQKTFREIPKKTPQQESKLK
KLLTQWDALWHSSRLYVERLKCIEILLSSLEDVTTKVSEVEHKLASFTHMPSEIKPLQKV
ICQLLVLQSKATAQQHVMNQLSDDAHNARRIVEESRKHRGPYDDLNRLDSDITRLNNRWS
TLVNQLSDRLRSCETAYGMLQKFTNAYDTEVNFVEDSYQKLNAPQDLETTKIYDHGVDKY
VDWLLADVHPSLDATVKLSKTDSSGGDIVASRLDDLNKKFLQLSSDIRGLLKDYSARNPQ
DKRIVVIFFFVKCPACGCQNVLSLKRICTKSVTYVDSPSAEQFFKSKMDLTENKSFKRIK
TVGEGIERDSVIDILGIVHPETNELLTVGEAISLRILDVRTGMFNAIVNNKITPISIESA
VKYGLIDGKLAEKLLGPCGVFENDREISLLEAIQQNISDAESGSSLEYLMKVRGTPVEID
KKDPILYQKFYFSKFGNNSPNDMTIQNAIEKNKLNPKTGLMTLENGEKIPVLDAFKSGIL
SSQFSRGKEKGLSLMDALEHGLIDGKGLIYDRQNGGKLDLDEGIKKGLINPNFREIVDSG
KDNKITVKEAINNKIINPKNGNYYHVASAELLPFHEAHRRRLIIKPMTLKEAVETGVYLE
GDHLLSPTHNDKINLLESIGRGVLDENRIKCVTDVKNDELITLGEAIGSGIILVDGKYVD
NSTGEIMTIPEAVRKGLITSVTIRSIFDIDAFENNNEFVGLNTALDRKIITLRGDEIYFK
HDNNFVTLEEGRAKGIIRAEVLEMLNKNIGIKDENGKELTVIEAVLKGYIDPKRGMIANP
KTQKLIPTNNAIAKGIITEEGAALFNSLLVVSLTTQTITKTIITSAGKLQHVGSVNFESS
DRGSNVSPAKMEFQVTPKKYAHEELKRFPVEVHHPSKRLKSSPDSTDFIVSEKINLRKEY
VDDQPGDVTVHSSIHITKGPEKKRVKKLIETISSETIQKTETITEKIIETHYSSSERKIK
SKSQPDVLKLETVNVEMLEPPERPVRTKNSIKKPETDEVVMKIHPEQITVPTGKHEDQSL
ETPEKKENFHSVSTVVITEGTPSRSALKLDPQSQFQSISSLTIKESVSPIKEDVSPERPA
RKKSKSPPVKSVPKSEKSKSKKPEILDTFKKDDPKNETRDTTDMESLQGIPEKKVPERKD
VTTTNKIVIDNSDQIKEPGRSKDDKSPEKTIKAFITGKNDVTDKTEPEVKVPVITPTKPT
NESPSKTVKSVNLKIDSFEESTNVKELPSKSDDVPKEFKDKPMQVIKDDKDASNYFIAHE
KEIMKPEVIKFDLSRDEKISPNVVDDGGRIPSQLVPDEKFMTAIQNEILELPEEGWYLSE
VINEKIFDSESGLFIIPKTDRLVSFEECIKLGIINPESVLVVNNVNSTLIPVDRALEKQI
IDSTGHYYFDREGKEEKAGAAVITMKEAIERELIIPKERDYEIEKNTRKKFTITKYFDYP
SLESYQSFSDANENENLKKKMNEVVLSDEEIENVISETGLLNDQIDTDLIKVKDPRFKDA
ISFKEAVDRGIIDKTTGTYKDVHGKLIPLRETVKTGVIVLLGATAMSPTKIIKSIRATFI
SEPKTGKDSSVEEEEEEEETLRKESMISRDEPKSLEVEENKRFESKDQKPDERVRDKTEI
IPLEKSTVNKPDDDVKTEENDDDIEESLGKKTRERVTTEPKYRVAIGRAHSLSPSLEQRA
KPVVLQKMRKKIIKPKEGLEHGIIDEKTMKMFENKDPHDTVLEALKKQKLDGDRGSIRDP
QIGDIITIKEAVERNIINPEVKEIELLIPVARSLSIPEVLKQGLINEEGTIIHPETGDDL
SLGEAIVCEIVNPLCNLLDDTGKKITLKDAISKGKVDENKSVLKTKDGDMDLMTASKKNI
FLNDEREEIMGIPKIGMTLPVLVQRGLIQPDGYIVHPVTQDKISIKDAIDKDFIMSYSPH
PVMPKSIPLMDALKENLVNTEKKTFLNKETGKEIPIEDAITSGLLVVKPEPSETIVEVIK
SYQTIRRKTMELKPGYILINPNEIKNVKTGEIMSLKEASKNGIAYEISETEETIQNLSDP
KKEEVNKSSPVEENLNKEKDKSGIVPDDVRVDETIEPESPVKTVQKTPLNLLEALEYIYD
DKTGRFKHPQKEGETIDLKEAIAYKIIDPTALIVIDGQEMPTETAIKNNLIDLKSGTIKN
SSGKKINIRKACKTGLLDSVKTPSGVKQDKGKDSKGKNQKEKSPDWKIPLEKSKENLNGK
KPVKDSKDSKEILPRKMDIIEPDVKKTIKVVLSSKLSPKDLHKMGIYDPDKNEFVDPETR
DLVPFNKWAHSFLNLNDVTVKNPSDLNKCVTLKDALNLGFIDPVKGTLKNPENDETISFF
EGLKLGLIMEKLPTETFLKFGVLDPETGKIKDLRTGKIINVFLAVKSGLLDEDNVNIMNP
ANQEIIPLSKAVKLGIVDLEKEFVINLNTNERIDLTEAFKTGLLIIGYRKPISLKAVIMK
KLYDDETGKIIDDITRKEFNLREAVSRGLIDSFISECKNDETNEWLTLEEAMKEKLVDGK
TGKIKMFSGKPNVGLREALEKNLIRTKPLKLSLIDGIRENYYSPENGTFLYPDTGTEVTL
KKAIIDLKFIDDGGVEIKDVDKNSVVSVREAMERGLLDGEKGILTSPPMNLKEALEKGYL
ITMEKPLPLSELLTRENYDSKTGKFTIGGNVDVPLEKAIELGKVNVDEVTVVKDRNSGDF
ITLSEAIKTGIVDTKSGIVQDPVTREKIHLLDALNDGIIIPTKPKYSLSEIVFKGLYNPK
TGKFVDPDTKEELSIDSAIEKGTIDTVNTLVKDTDGNMITFEEAVKKGIVDVKKGIICKL
GSKNLELDFQEAFDRGLFVEIRLPMTLTESIIKNVLNKESGKFLNPNTGKSVSLKEAIDI
NLIDPNSVEVKDTTTGVWKKMPLVEAIRNGLVDGDSATVKDLTNKKNYSLIEGLELGLLI
DNKAAVSVQRAIHQGLYDEETGKFSDPNTGRKITLHEAVRQFIINPLLPCYWNEKTESLM
PLSETCRAGIIDRRAGTFKEPDSDSSVPLSKALELGLMVDIETCNFDLYEAIKMGLHDDG
STLFVVPSTGRKLNLKDAIKEELINPKGSFIKNTADGEYVKLDEAIEPLKIIDDEKCLYI
SGDDCMSLKEATRKNLIIPSHRPYAIDEAIKYGLFKSDVGRFIDPETGRAVDLVQGMACN
LLSSEFIFVKDPVTQQVKNINKAIDDGIVDVDRGLIVNHKTNAVFPLDKALADGILLSVK
HPLTGSSPASFSKTSKEMIPGEKYTLEEFIESEIINPDEAVVKDFKTNQYKSLKQAIIDE
DVDLSEKGIYEKTTVENQNMPIVLKSGIKVFLKEPLTFDEALDSKHLSVVTGKFTKPKTS
QQMSLKDAVQSGIVDSDSAVVKDVAKCKLLNLSEAFEKGLIDSDKANVVDSETSKLYTLA
KAINSGLVLTPRVGLPLIESLKYGLYDSNTGTFVDPFSTGNAMNEKKRLTLNEAITSGLI
DPSSTMIKDSSDGNVVPLSTAIVNKLVDGDSGQVKDVSNDEYLDFLIAQQKGFVLAAKAR
QAMEEKYKICDDALQKLLNWLGDVETTVSQQDVVKEDSEQLRNQINTIKAIKDDIHGHNR
PVTTVLDQIRQIVATGGEVLSAEEISNLEKNGQNLKKRFDKVQDRTDKLLKKLIFARDEL
SKFKTELSVFCTWMDKARKTLEDKEKILSDLNKLPSSIEPIRDFVSDVIVHQADLRFITM
SAQKFVDESKEYLSCLNEFRTSLPQRLPHIEPVSSQDSMVRNEVSAATTHYRELLSRSNT
LSDRLSGLGGRQREYRDALDKAKAWMREVEPKTTKLVSEPLGAEPKAVEEQLSRAKSLNA
EFMSNGRLIDSVKQAVTILLRSLEGQQTPSDMEALEVPVKELENKYVQLSEALSEKLQAL
DAALVQSQGLQDALDSLLQWLNTIESQLKAHMKPASLNKDRLEDQIREQRLIHAEIENHR
GSLESVAYSAQDLINTSSNPRLASKIQSKLSDMLTRYEKIQLKTLQRGDFLDEIFQCLSN
FNVQVEHFEQWFTDLIEQLESRELNKLTHDEFVTKIEQLSDKRDQQKNKYEDMIGNGKNL
ISKKDVSDVGIVREKVKTLESMWKDLNSGLEDKQKSSRARAEQLSAYENLRETVLDWLSN
MESKISRLETVALDLTILKRQADELKPMIKEYKDYATTLEKLNDLGSAYDSLMRYDSPTK
RRSSAYNSLKKSSLSQRPSVVDGRSSSPNKNYMNSIPLSSPLGFGSRRLSTESFHLEDSS
PVQSQISEINNRYSLLGIKLNDRQTEVDTVREEVKKYLENLKALAQFLDKVQRQLPKEFV
PMTRDESDKTAKAIKVVLEEMYEKQSLLDNTRTQVKDLLKRKGNAPGADRLFDELEDVTS
RWKILNDRCKSRIKLMEDIKEFHDTHDGLHNWLGAKDKMMSVLGPISSDPRMVQSQVQQV
QVLREEFKSQQPQLVHLNEVGDSVFSQIDETSTDGQRLSTKLKSIKERWADLLAKLEERA
SSLGAAADTSREFDAGVTRLKDALQAISDQLDELPLDKDPEEQLRKIQNLERQMEGQRPL
LADIEAAGVQLSEVLTDPASRSEIQTKLAALARQYNTIQKKLDHRKAEIEGSLRDGRQLE
QSCARTVGWLSDELGSLSEKLLISADKHILQQQLDQYEPIYKDVVNKEHEVIMLLNKARD
NLSRSGQRPDSRNLQRDIDKIQQLWDKLKKDTVERHTRLQTCMEHCKKYYRVLDTFVPWL
RTAEDRLDTLKPNTFKRKDIEKQLKELSTFRNDIWKHSGEYENTRMLGETFHGACDVDKE
VVKSELSNLKQRWDKLNNDLLERTQVLEDTARSLTDFNENLRELEHSIQRCEDKLSNHDV
GDPKLLDKIRILKEESSGLHKPMQNVRQQVIDLVGSARVVGGDAGHLQDDVDVLGERLDH
LNAILDDRCSELQSAATAVQQFNEKVKNLFIDLNNLEQELDMMKPAGRDIKTVRQQLEEV
ALFIKKLGKASDDINDIVTAGDNLVDSGFTPDNLQTREQADSLQRSLARLDDRARTREED
LISVLKKLEQFYELYTVVTDEINEVIEEVRRLKPVGSEVEGIKAQQEESRALRRNVFEPL
GHQVTDCNKKGQTLIQSAAGGVNTTVIEKDLEKMNDKFNNLKDKMNERDRKLDVGLLQSG
KFQEALDGLDKWLSDTEEMVANQKPPSADYKVVKAQLQEQKFLKKMLLDRQNSMSSLFTM
GQEVASGADPSEKKGIERQLKELMVRFDKLTDGAQRRMLDLEQAMHVAKDFQDKLVPIVE
WLDKAEKRIKEMELVPTDEEKIQDRIKEHEDLHSEILRKKPTLMELTEVADTLMSLVGED
EAATVADKLSETADRYSVLCDNSDAVGQLLEASRAGLRHLVLTYQELQAWMETMEKRLNT
HRALGVHTEKLLQQMDDLANLTEEISDRHTQVDSTVDAGLELMKHISNDEAIQLKDKLDS
LQRRYNDLTSRGSELLKNAQEALPLVQQFHNSHHRLVDWMMGAESQLQREPRQEDIERLE
GDIQEFRPVLESINLVGPQLCQLSPGEGAATIEGLVTRDNRRFDAIVEQIQRKAERFNLS
KQRSLEVTADMDELLDWFREVENTLREVEPPSSDPDAIRAQLKEHRTLQDDITSQKSRGR
DVLSTAKKVLREASQHDDTITIREKLEDLREVMDIVSSLSSDRLGILEQALPLAEHFLET
HTGLTSWLDDIETQVNALALPALRPDHIAQQQDKNELFSQWISDQKPLVDKLNKTGEALI
RLVNDDDGAKVQDIIDAHNSRYSALRAHLRQRQQALEQALQESSRFSDKLEGMLRALQNT
AEQVKVSEPVSAHPPKIRDQLEENNALVEDLDSREEAFEAVKRAADDVISKAGNRSDPAV
KDIKRKLDKLNSLWGDVQKATADRSRTLDETLIIAERFWSELQTVMASLRDLSNSLNNQE
PPAAQKEAIKVQQEILQEIKHEIDQTKPEVDQVRQTGQTLMKICGEPDKPEVKKHIEDLD
NAWDNITALYAKREENLIDAMEKAMEFHYTLQNLLEFLEKAEDKFAGMGPLGSDIEIVKK
QIYQLKDFKEEVDPQMVKVEALNRQAHELTERTSADQALAIKEPLNQVNKRWDDLLRGMV
ERQRHLEQALLRLGQFQHALSELIKWIIGTNNTLDTDLKPVPGDPQVLEVELAKLKVLVN
DIQAHQSSVDALNDAGRQLIESSRGSQEASSTQEQLKTLNRQWKDLLEKASDRQRELEDS
LKDAQRFNAEIQDLLSWLSDVDGVIAASKPVGGLPETASEQLQRFMEIFDELETNRPNVE
SVLQQGNEYLKRSSTATNLQHNLKTLKQRWDSVTARANDKKIKLEIALKEATEFHDALQA
FVDWLTNAEKTLVNMKPVSRVMETILSQIEEHKAFQKEVSAHRETMLNLDKKGTHLKYFS
QKQDVILIKNLLISVQHRWERVVSKSAERTRSLDHDELARETGNDPERIKQRLAKHREFQ
RALSGKQSSYDNTMKAGKTLKDKAPKSDEAPLRDMMNDLKNKWTAVCAKSVDRQRKLEEA
LLFSGQFKDAVHALMEWLQKADKILSEDEPVHGDLDTVNGLIDQHRQFEEDLQLKTNIDV
VFFQGRSVQFEQVKRTGRDLQEKASHADAQTIRTQLQELTTLWERVIRLKERQLKRLEEA
LREAQQLHKSVDMLLEWLSDAEMKLRFAGILPDGELETKTQIAEHEKFLRELSEKEHDKD
ATLNLAEKVLAKAHPDGASIIKHWITIIISRWEEVYSWAHQRRARLEEHIRSLRNADELL
EELLAWLAKLEKTLVALESEPLPDDIPTIRQLIEEHKDFMENTQVRQGEVDSVCKSRQVQ
AATKDKKTSRPKTPSKEYDREGSPDLDRKSSLAKSRESLLGKDPSRRGRLSPVRDGKLDL
PHYGPRFPPKGAKGTEPTFRSPRVKLLWDRWRNVWVLSWERQRRLQEKLVYLLEIEKMKN
FSWDDWRKRFLKFMNHKKSRLTDLFRKMDKNNDGLIPRDDFIDGIMKTKFDTSKLEMDKV
ANLFDHHNGFIDWKEFIAALRPDWEEKKPETEAEKIHDEVKRLVMLCTCRQKFRVFQVGE
GKYRVSPEIFIYLFIPVVFGDSQKLRLVRILRSTVMVRVGGGWVALEEFLQKNDPCRVEL
MPIPDPNKPEEHDPWCIYGVIETGKNGRTNIELREQFILADGVSQSMSAFKPKTSASSRS
TSVTSSSAGPITKRETVSDCVLSLAEEFMSHLMPIIESVRAQQTVPVAYPLKIREKSLKS
VPMGSTRGTRSSISQGTPDSLSDNEGGVGGGSGGYSGRPTPRRSTSSYRSSVTPSGSLPG
SRNSSRPASRTGSKPPSRHGSNLSLDSADDSTPGRYSKTSMGSRTSSARSRLLVPNGSSY
GRPKTPTSGSSSTMGSSSRSRIPIFTGFTPEHPQSSSGQQPMRKLMTFNTTKGLCSLSVN
LNDLKKSSSDLTPVKKTSSAMPGVTHYEAEPKKTVKTNTTGNNDQEIGDRSSSSSSSSKN
LRIRKTIGSGSGASKIPMPNEMAKKSRIRSPGTIMMKETKKSSEDRTLSNPSLSESSSSF
KGDDDVNDDVNAGTVTTEGDEKIRRTQSTDSIQK
Download sequence
Identical sequences E0VIH8
vb|PHUM227910-PA|EEB13184.1|Nesprin-1 XP_002425922.1.24195 121224.XP_002425922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]