SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM353010-PA|EEB15173.1|Centromeric from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM353010-PA|EEB15173.1|Centromeric
Domain Number 1 Region: 1224-1427
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000412
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 2 Region: 973-1133
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000451
Family Tropomyosin 0.0088
Further Details:      
 
Weak hits

Sequence:  vb|PHUM353010-PA|EEB15173.1|Centromeric
Domain Number - Region: 1498-1686
Classification Level Classification E-value
Superfamily Tropomyosin 0.0019
Family Tropomyosin 0.003
Further Details:      
 
Domain Number - Region: 439-623
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.004
Further Details:      
 
Domain Number - Region: 735-874
Classification Level Classification E-value
Superfamily Tropomyosin 0.0314
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM353010-PA|EEB15173.1|Centromeric
Sequence length 2284
Comment protein E, putative|DS235357.1:20710:27977:1|gene:PHUM353010
Sequence
MVFHVFEANKFSKINNQLSIPDTIPEQSGELSLSSSKLNDIKNDSDSCKKSDGNNSVEDI
ETNKSNESLNASTIIPLESSFLQDCEHRLLDLSCSDEEKSFKIMNNSLENSVLKVISSKL
GLNNVTISTPPSELRKQISILRDEMAESHEFHDLEMKILEEKDSENYVQLIEKYSALLDL
YTSLKKEYEDYRSEQEKVRDELQDKTANCLQNLCSQIEASDSSFTFNDISFTSLNNDVKS
STILENISENEISVANSTLLTTNDPLAISKIDVFKTPLTTPKRSVKKKLLQSLSSVKLKS
LTKDNISFNMSKGDDLAYFNVEQNNKITNLQTMLQARILQVEELEKRLFKVEDLLPQLES
QSDKIISDLKDENLQLKNDLSKKSDQLNDLTQKLITEIIDLNPSLKDSLNDYSATKILFL
FIETIMDSCKNVQGETLEKWETEKSEWKKQKKADTDLIENLQNQSKILKNEMAGYEMELQ
SCKEEYDNLKLKYSEAETIIKKQDEEIKSLKFYESDNSKVHENLLKSEETIAKLQSDLSV
LENEKTNIFNKYQELESKLISMESEIKTKVDELVNINNLYNDSKLKNESFAQQLKVSEES
TLKLQNDLDLIRKELNCNDNKFSEEITHFKKENKDLKNIFTALMDNKITLSEFIANNTDL
SDMGNSDSTQFFEQLKPIFRDCLENESERFLLIIIETIFSCCKFMQQKIAQDSDSEKNDS
KSSENSNCILFNATENHVNFLKNEMDNCERDLRHYKNLHDMLKIELFDFYSAITRQIEEI
ESRQSETFCKTQQITRELQMKLLIFAKERIDLENKYNELENKMKEKEGELETNTNLLGEL
KIENEELKQSLEKFKESVTLREIELDKITNELNCTQNKLSEEINSLKKENEEFRSLYAAL
INKKEIITEFFGEKYNYDQVFSESLSERLKPLSSSLISEKENEKLCLGVTETILSCCEFI
RGKLKEINKKDEENLHKEKALVDDLNEKLKAEIETCKEELSACNVELNEYKENYESMKMK
YSDVESEIVGCRVNLSSAEEKITELENEILNLKNVKIELENKCTQLEDKLSILQSELNDK
ESNVQNANTLGVELKMENERLSKLVEKSEETISRLREELETIKSEAKNNDNRLSDDIGNL
RKENQDLKNIFTVLRDCKTKISNACNEIFNLSTAEKINRDEFIETSRTIFEEISSENKNK
DSFLEIIDVVFDSCESIHKNVTDHLKKEFDNFENQKASYIDSVKDLQSQVENLKNDLGNC
ESELEKCKEQNETLKQNGFEFESTISKLEKEIESLKVHESDKRKIQENLNQAQESIANLE
SELSAKESEKIDMVDKIKELNEKINELESEIKMKESEVEKWIKIHDELKVQNEKLSKTLE
NSEKFIIELEKELKASKDELTWNDNKSYEEITLLKNEIEKMKNTISSLIRWKTSVAEMVA
ELSDIRDVDFSTYHEKIKSIPIEFSEKELNAEVLSDCVQIIFNCCESLKLKLSADNDTRR
ENYESQKKIDDDLIQNLRDEAKSLKDEIKNLEIELKRCSEVQNDFQVKFSNAEKIISNQE
EEIRLLQLQNSELSKIRQDLSSSERIISNLKSEMEALANEKKEIENKYNESIRKNETMAS
EIEKKEIELKNVNSFYDELKLGNEELTKLLRDSEGSMSHLEEQLEIVKKELSSSGDKFSE
EITHLKKENSRLKHVFTVIVDKRTSLSELFSKVFNMNDLNDFESIKISDRIRPIFKNSLE
DAESEKYLLNVAETIFTCCEYLERKIRKEKEMDREIFTKEKNTYENLVKDLNVRLESVNG
EVEESKIKLREMESHKTKCTELFEKINENENVISRQKELLERKADDFEELAKKVKILEEN
KKNLTDIILDVQSCLDMSDDTITKLTSGNFENRKILSESINVHIKLQMENLRIENSNLKM
GSDNLKEKVKELSKMITDMSNRQLRDEMSSSSLSTLNHSLSNSRVLRSSSGSGRSELCAR
RLDKLEETNQNLTELITRILTLTDFPNVEKLKFMSVREFPSTSKKIIGHIDGLLAEMKEL
KETNATLDEECESYAETIKEMKKEEVNVWKSNMEKLEKLESEKTCLNKEKTELEKERKNL
LEKITKLENECQKLRAKTTSDDVNAFSCACGKESKKIHDLKRMILIKEQKILELQDLESQ
NAVYNSQIKYLEHALQQEKKKVKLEKDKSDKLRKELDEMSSSGGGNNQKKSSSDDNEMLN
ELRMCGSVSGGGGGGGVVQEFFDREKMRKLSKDIGILKELCRARYAEIKRLEAENASLKA
LKSK
Download sequence
Identical sequences E0VP67
XP_002427911.1.24195 vb|PHUM353010-PA|EEB15173.1|Centromeric 121224.XP_002427911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]