SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM422450-PA|EEB16419.1|group from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM422450-PA|EEB16419.1|group
Domain Number 1 Region: 132-532
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.29e-30
Family Pyridoxal-dependent decarboxylase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM422450-PA|EEB16419.1|group
Sequence length 790
Comment II plp decarboxylase, putative|DS235755.1:154774:158751:-1|gene:PHUM422450
Sequence
MLLKSNTKYFAESPKNISPVSEIEIQASQIIERLEGAVEKAVEAVSALEIGNEKDPNFKE
SDLGLKGSSWGVDQGYLQAKSKEVPQILNLLEDLLIFENDELDENDAPTVASLAPLSNVG
KFTFIIQSVAYFANTLGRSHVNKLNYKIHNETTKWLTNLFRINDSQAFYHDEPLEGLVRL
TRMLLHYKYPKFLELGFESLCSTPPVIYSTLSSFGLVQYICRQLGLPLSCVRSLTSSNNI
EPLQKLDLNYVQKIINDDKNSNKVILLLFADAGTPITGHMDDLFSLQELCQKEDIWLHVK
GHNLAALTLMNALKIGDSLTLALGAWLGIPGLPTVTFYRQIRAKERKSGEATWEGALPRI
AGLVPDQLQKCLVALPVWFALQALGRDEIKLRIKESFIACEILWEKLIKYPCLRLLSQKP
GGNLIASHFEDTNKSDFIPVTIFEVIASTVVFQFVPPNQDSDYCKTSVVSQYCNKLNSWL
GQILQRDVPQINVEICELENAGLVLRICPLEAIIPICGNDIEIFISSLEQHLDILSATVR
LKPIFLKCVENNPSLQLVEMDGWAGLGGVRYVPENINDADSDQSKQDLNKLNIEIVNKLR
ATDAAFSIGEGNNGLVCVRFGMVTADTDVEELLSLVTSIGKNVEESSKYLEKMVEIVKKG
IETATVDLRKENEERLWQDGILRQVPVFGSIVNWWSPKAKESGIKGRSLNLQAGVVESTE
NIYRYHMQLEQGASSPPGTKSPPQPIVQTPIVTDSSSLHSRSSSHSSQLSQKSTENKNTL
SNINNQTSKN
Download sequence
Identical sequences E0VSR3
XP_002429157.1.24195 vb|PHUM422450-PA|EEB16419.1|group 121224.XP_002429157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]