SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM424550-PA|EEB16498.1|Sply from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM424550-PA|EEB16498.1|Sply
Domain Number 1 Region: 98-501
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.29e-112
Family Pyridoxal-dependent decarboxylase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM424550-PA|EEB16498.1|Sply
Sequence length 554
Comment sphingosine-phosphate lyase, putative|DS235758.1:468392:470689:1|gene:PHUM424550
Sequence
MAFVKTQICGIKGFINEYFKEKEPWQVVVITASTVFTLTWIHDCISKEINLVDSGKKLFF
KLIKKIPSVKNKIDKELKKIENEFVSDVKKRNKGNNYILELPQNGMSSEDILKLTDVYLN
SGEYKWENGKVSGTVYYYNNQLVELITQIYGKTSYTNPLHPEVFSGICKMEAEVVRITAN
LFNGGPESCGTMTTGGTESIIMAVKAYRDYAFFERGIKYPNMIVATTAHPAFDKAAQYLK
IKIIHVEIDSKTTKVNLNAMKKAITQNTCMLVGSVPNYPYGTMDDIEGIAALGLKYNIPV
HVDACLGGFIIPFMESAGYHIPPFDFRVEGVTSISADTHKYGCAPKGSSVVLYKSKSYLH
HQYTVTTDWTGGVYGSPTVSGSRAGGIIAACWATLMHFGFSGYVETTKAIISTTKYIENK
LKEIDEIFVFGSPITSVVAIGSNTFHIYRLSDALSKCGWNLNPLQYPPGIHLCVTNLHTR
KGVAESFIEDVKREVAVIMKNPDEEVKGKMAMYGTSANLPDRTVVGDFARIFLDAMLYIP
EQESKLKDSDSFKN
Download sequence
Identical sequences E0VSZ2
vb|PHUM424550-PA|EEB16498.1|Sply 121224.XP_002429236 XP_002429236.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]