SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM537630-PA|EEB18881.1|transcription from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM537630-PA|EEB18881.1|transcription
Domain Number 1 Region: 401-499
Classification Level Classification E-value
Superfamily TAFH domain-like 4.45e-33
Family TAFH domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 713-760
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000237
Family TBP-associated factors, TAFs 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM537630-PA|EEB18881.1|transcription
Sequence length 921
Comment initiation factor TFIID subunit, putative|DS235854.1:343754:347731:1|gene:PHUM537630
Sequence
MASTQFLEEALSTDVDESAVNALVGSLETQLVPPTSVQSNADGKVVQNHVNNTISNGGIV
QKHGVSNEESEGLVNNAGGVIPDGNSNTKQTLVRSTSLAHSAVVNTVVTSLSGLPISQIG
PNVITKSSDGVKIVTYPAGNQLGSPQVVNINNRVSFPQTITLPNGSIPSSVISSVPSNVQ
TIVTNSPLNKSLPGAINVIKVDQGQPSGATLVIKTPGSGPMTAGSMTLTQGTPGTTAAPG
IVTLAKPLMAGQSVGNTVQILNVNAVRPGTPIQGQKGLPQHRVVINSPQVISRPGAPNQP
TQITLSPLQGLQPGGSGHILVKSESGQLQLIRIGPAPTATPGAPSGTIASNNASQFRIQS
LPVQQGSGSTAAVVIATSTAGSIQSSQPPGLTATTPKQQMDTTKEKCRKFLANLLELSSR
EPKAVERNVRTLIQELIDAKVEPEDFCDRLEKLLNASPQPCLIGFLKKSLPLLRQSLFSR
EMTIEGIRPPPQQVVSTTASVAQVPQMQAQLRPQMVTQTVRVVAPLNAAGQNISVTTPRM
GTLQNRGQIPAQGKIIATSIRGQTPLATSTQPPPLHHTTPISSQTPSSPPVHQIRPTTPA
RAAAPKNQTTKTPVKQVITKTTVQTKSNANNSRSINVIAKPSTPSVTNKSISKVISKGGY
EELKFGATSFSGDDDINDVAAMGGVNLAEESQRILGSTQFVGTQIRSVKDEIFLHSIPLQ
NKIRQIVSNHGLDEPSSEVASLVSHACQERLKTLIEKLACIAEHRIDVIKLDSRYEVVQD
VKGQLKFLEELDRVERKRHEEQERELLLRAAKSRSKSEDPEQVKLKAKAKEMQRAEMEEL
RQREANLTALQAIGPRKKPRLDGPGNSGDASGTGSSGTLFGRPHLPLRPRLKRVNLKDLL
FLLEQEKETSKTNLLYKAYLK
Download sequence
Identical sequences E0VZS5
121224.XP_002431619 XP_002431619.1.24195 vb|PHUM537630-PA|EEB18881.1|transcription

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]