SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM580780-PA|EEB19589.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM580780-PA|EEB19589.1|conserved
Domain Number 1 Region: 334-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.56e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 142-196,225-240
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.49e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 
Domain Number 3 Region: 57-128
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM580780-PA|EEB19589.1|conserved
Sequence length 607
Comment hypothetical protein|DS235873.1:395482:397976:-1|gene:PHUM580780
Sequence
MIQLKKKKGNFKRFLFFFGTIFPICIIIIIINIFLSVDRDFDDDVVGKDDKTIRTNDDKK
QNHSEIEKRRRDKMNTYITELANMVPICHANPRKLDKLTVLRMAVQHLRSIRGTVHSYTE
GHYKPTFLSDEELKNLILQAADGFLFVVGCDRGRILFVSESVSEILNYSQSDLLGQSWFD
ILHPKDVAKVKEQLFSSDLSPRERLIDSKTMLPVKTDVQPAGISRLCPGARRSFLCRMKC
RGSFHVKEEADTTTGCHRPRKKQSNSDRKYNVIQCTGYLKSWPPVKLGLEETEGENDSES
CNLSCLVAVGRIQSQMNNNLHYYFPTANIRQFPFVSRHAIDGTFLFVDQRATLMLGFLPQ
ELIGTNVYEYFHQEDIRTLSETHKLALQSLQVTKTQSYRLRTKDGSYIRIQSEWKPFKNP
WTKDIEYLISKNSVVLTVDSSVIRSEGPTQSNRNYDPFSTNVQRVPSSHVGPSLIGQQIA
REIVLRRCDDNNYANTPSPSGIDASDVTIQTTSNPESVMSTSDNDGRISSLQRINLNDMN
NVNIKHHSIRNNVSLTAAASSGIDDSDAEMLEMMSGTAAMAVIMSLLEADAGLGGPVDFS
GLPWPLP
Download sequence
Identical sequences E0W1Z5
vb|PHUM580780-PA|EEB19589.1|conserved 121224.XP_002432327 XP_002432327.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]