SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM613040-PA|EEB20343.1|Neuronal from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM613040-PA|EEB20343.1|Neuronal
Domain Number 1 Region: 336-438
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 166-218
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000589
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.07
Further Details:      
 
Domain Number 3 Region: 65-115
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM613040-PA|EEB20343.1|Neuronal
Sequence length 801
Comment PAS domain-containing protein, putative|DS235885.1:142293:150725:1|gene:PHUM613040
Sequence
MDYAVTSSFQRHQTGMNVNLGLTRPDLNMNLGMSSAFTHSWFVPGDACAPISHQQTGHVL
ILELRKEKSRDAARSRRGKENFEFYELAKMLPLPAAITSQLDKASIIRLTISYLKLRDFS
GHGDPPWQRDNPPPNKSLKGPSRRTPAGLAIEMFEQHQGTHILQSMDGFALVLGADGRLL
YVSETVSIYLGLSQVEMSGSSIFDYIHHSDHAEMAEQLGLGLSQSQGLSSPSSGNDDVNS
SSGTANPDVATQMSISSSSMYKGLDRAFCIRMKSTLTKRGCHFKSSGYRVVLLLCRLRPQ
YTFSHSRKSPPPLLGMVALAIALPPPSVHEIRLESDMFVTRINFDFRIAHCEPRVSELLD
YTAEELTGRNLYTLCHGEDANKLRKCHIDLINKGQVLTHYYRLMNKSGGYTWIQTCATVV
CNSKNAEEQNVICVNYVLSAREYGHLVMDCCQLENTNPTIKRETRQDPENGSPDADQGGN
GGPASFTPDSHNSPPNSEGRSPESPSEKQTRPDQTTQLQGTSTCDRIKVNRPVVNASITD
LDKSRTQRKSKKRKVGHEVESSEEEEITKRSSPISEHSNPPQDNAGGTVKDLEDAMSKHL
PNTSSPAHQPTDFSTDALLKQQRGAIQWVGHHLGQAMPASALLRQLYANRESVIRANVHA
GGRTPAGGGYYSDGQGPLPTPPGSEGSSTYGDHQFGKTGPNDTFSTIPYPGYHVDYHSAM
TPPSSVSPRDKHQLLDYTELRHPYLEPTPPAQPLPLKPQAYSAHPTLDYLDQYQGAGFHL
YHPNKSYTDPHKTGNWYSATS
Download sequence
Identical sequences E0W3Y7
121224.XP_002433081 XP_002433081.1.24195 vb|PHUM613040-PA|EEB20343.1|Neuronal

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]