SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for vb|PHUM614470-PA|EEB20385.1|AMP from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM614470-PA|EEB20385.1|AMP
Domain Number 1 Region: 8-242,274-523
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.98e-41
Family Acetyl-CoA synthetase-like 0.00079
Further Details:      
 
Domain Number 2 Region: 634-981
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.02e-37
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 3 Region: 542-595
Classification Level Classification E-value
Superfamily ACP-like 0.0000445
Family Acyl-carrier protein (ACP) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM614470-PA|EEB20385.1|AMP
Sequence length 994
Comment dependent ligase, putative|DS235886.1:194761:198365:-1|gene:PHUM614470
Sequence
MESREKFLNNFYNICQKFSDNISICWVSKCSETFGITYGELNKVSNELKCLFSRLFDENI
SRYVGIQITDYSVLPILFLALWKNNLSVAGLGPQYSLEDNVKFLDLLFVKFIISNNECSD
YNLKIANCFYINNQKYFLYERNVVHKEKFTNNWDMCYGIMTTGTTGTLKVIQVPWSCILP
NAEELSDEFCISELDCIFQASPFTFDPYYIELFFCLLRGCTLLIVSDSLKLCSSNLLKIL
FNSQENECLNEIQSNPCKQCKDCIHVNIKLIVRKQVTVLQITPSLFKRWTNDGIKQVILS
HQSSLRILMFGGEKFPKEILNLKPPDNKTKIYNLYGITEISCWSFMYEIPFNSSCEEVPL
GSELNNIVYKLNDKNELLIGSNKRICLIDDETSLNSQELVFRNTGDIVKFENEKLFFICR
SYEIVKKYGIKVNLKKIEECFLNENDSIKSCHCVFNEKINKLGLFYSGKNNSKMKLTSYE
NFIENGYNYPVNKLQDIEKPDYLIEISQVPLNTHGKCDKTKLLSYLEELLVLRNTNLNVK
NVFKNAWNDVLRANIPNLNSESFTSLGGNSVLALQLIGKLEDAGLNVPQDLILQILNGNS
FEDCYKSFIYNTAEGPLKKKKKFIEDDDGSEDNFNLRIKWKHDLGKCIDATPTVFNYLGE
ERVIVGSHSFKISCLLITSGDVLWTKTLGGRIESGVAITKDGTLGFVGCYDNFVYCISMI
DGSTKWQFKTDDMIKSTPCLDSKEKVLFVASYDRHLHILDVESGVLQKKIKLSEKGIFSS
GCISKVYNTFHIATLDGTCVSLSQITFEIDWKIKLKSPIFASPCLINDDKEIIFTEVFGT
LHCFDIFKGTNLWNYTAGGYIYSTPTFYFLKDMKSIVFGCNDSNVYCLRVDKEIDLLWKR
KLDSSIFSRSSAFHLGEVNAACVASTKGIVYILNLLSGNVFTRIKLNGEVFSSPIFINNE
FVVGCRDNYLYTFFFININNGVKMDVEVPPRLAI
Download sequence
Identical sequences E0W429
121224.XP_002433123 XP_002433123.1.24195 vb|PHUM614470-PA|EEB20385.1|AMP

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]