SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91792051|ref|YP_561702.1| from Shewanella denitrificans OS217

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91792051|ref|YP_561702.1|
Domain Number 1 Region: 557-1044
Classification Level Classification E-value
Superfamily ALDH-like 9.42e-131
Family ALDH-like 0.000000394
Further Details:      
 
Domain Number 2 Region: 197-541
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.41e-107
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000518
Further Details:      
 
Domain Number 3 Region: 23-196
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.88e-63
Family N-terminal domain of bifunctional PutA protein 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91792051|ref|YP_561702.1|
Sequence length 1064
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Shewanella denitrificans OS217]
Sequence
METIMMFKASEVLAGRYDDATLDQLFQAVTDNYIVDEEAYLTELIKLVPSTDEQIEQVTQ
RAHDLVSKVRKFEKKGLMIGVDAFLQQYSLETHEGIILMCLAEALLRIPDAETADALIED
KLSGAKWDAHLKQSDSVLVNASTWGLMLTGKIIKLDKKLDGTPSNLLKRLVNRLGEPVIR
QAMYAAMKIMGKQFVLGRNVKEALNNSEAKRSLGYTHSYDMLGEAALTDKDAKKYFNDYS
NAIKELGAQSYDENESPRPTISIKLSALHPRYEVANEGRVLTELYATVIKLIVQARELNI
GISIDAEEVDRLELSLKLFKKLFNSVESQGWNLLGIVVQAYSKRALPVLCWLTRLAKEQG
DEIPVRLVKGAYWDSELKWAQQAGEAGYPLFTRKAGTDVSYLACARFLLSDATRAAIYPQ
FATHNAQTVASIDAMATDRNYEFQRLHGMGQELYDTILAESGAKTVRIYAPIGAHKELLP
YLVRRLLENGANTSFVHKLVDPKTPIASLVVHPLVTLQAYKSLANKNIALPADIFGAERK
NSKGLNMNILSEAQPFFAAIDKFNDTQWQAGPLVDGKTLTGDINTVVSPYDTKQTVGQVV
FADQQAIEQALASASHAFPSWARTPVETRASALQKLADLLEENREELIALCTREAGKSIQ
DGIDEVREAVDFCRYYAVQAKKLMGQPELLPGPTGELNELFLQGRGVFVCISPWNFPLAI
FLGQVSAALAAGNTVVAKPAEQTSLIGYRAVQLAHQAGIPVEVLQYLPGTGATVGSAITA
DERIGGVCFTGSTGTAKLINRTLANRDGAIIPLIAETGGQNAMVVDSTSQPEQVVNDVVS
SSFTSAGQRCSALRVLFLQEDIADRVIEVMQGAMEQLAIGHPGKVQTDVGPVIDATAKAN
LNAHIDHIKQVGKLIKQIQLPAGTEDGHFVAPIAVEIDSIKVLEKEHFGPILHVIRYKAA
DLSKVIDEINSTGFGLTLGIHSRNEGHALNLADKVNVGNVYINRNQIGAVVGVQPFGGQG
LSGTGPKAGGPHYLTRFVTEKTRTNNITAIGGNATLLSLGDSDE
Download sequence
Identical sequences Q12RE7
318161.Sden_0689 gi|91792051|ref|YP_561702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]