SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91793396|ref|YP_563047.1| from Shewanella denitrificans OS217

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91793396|ref|YP_563047.1|
Domain Number 1 Region: 437-527
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000334
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91793396|ref|YP_563047.1|
Sequence length 578
Comment sulphate transporter [Shewanella denitrificans OS217]
Sequence
MPGLQSLSKYERHWLKDDVRAALSVAAVALPVAIAYAQLTGVNAAVGLYSCVLPMLVYAL
MGTSRQLIVGPDAATCAVIAAVVTPLAAGDALKHWQLVMTMTVMTGFWCLIASRFKLGVL
ADFLSKPILMGLLNGVAITIIVGQFSKIFGFDFEEKYLLERLGGVPTYLSKTHGPTLLMA
LLTVAVYFAMKRFRPAWPSSMFAIAAGGLLVWVFNLGQFDIKTIGSVAGGLPTFQTPTFN
LGIARELVMPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGFANIASALSQGFA
VSGADSRTAVNDANGGKTQLVSIIAACIIAIVAIFLTAPLEFIPSAALGVVLVIASIHLI
DLKAIWKLRLRDRPAFFLALTTLFAVLFIGVIPGITLAVLLGLFQFLQTVMRPTDQVLGL
DSKGVIRSVDNDEKAKAIPGVFIYRFNSPLTYFNATYFKRRLLERYVKESEHADCIIIDT
VPCFTHLDLSVMAMLADLEVLFKKRGVRLILAGRKRQMIGWFQQTDMKFGDGGIVIRSDL
YLAIKLNQHYKAALAEGSAAVVQKQEDDKDKVLTHSQL
Download sequence
Identical sequences Q12MK2
WP_011496480.1.19895 318161.Sden_2042 gi|91793396|ref|YP_563047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]