SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|143818 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|143818
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000377
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 121-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000231
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|143818
Sequence length 152
Sequence
IDECMVDNSCNPLTSDCVNLFGSYECQCKSGFESAHCKPDLKCRSSPCKGIGSICQNKKG
TYKCSCMPGFKMIDLDVCEDINECLDNQPCGRHQCQNLDGTFTCICPTGFMFSIITKNCE
DVDECQMNRCDKLTTDCENTVGSFRCVCKEGY
Download sequence
Identical sequences T1EJC5
jgi|Helro1|143818 XP_009029277.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]