SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|154236 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|154236
Domain Number 1 Region: 163-313
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.12e-32
Family Deoxycytidylate deaminase-like 0.0021
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|154236
Domain Number - Region: 35-134
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.073
Family D-ribulose-5-phosphate 3-epimerase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|154236
Sequence length 317
Sequence
MASKKKFKPDCEELPVAVLSDEVYAKVELVPVYASTIKVKTDTSKIVKWLSQHFPVKDLS
HLKRVRKRAGIENMEEECGLDVIICSSIDCYSKRDLIDRIKNFKCTANVSVENQNAPDYI
YNLIKSAFLVKVPLLPATTRDQFVEASRYWPVSFHEDKNVTSLLQKHIFSSSDLHKHKMN
MKRAFDKSLENSREIAPVIGCVIVDPSNGEVMSASGDTRDEHPLHHAVINAIDSLARHQS
ANFDPSNKTGPYLCTNYDAYVTVEPCVMCAMALLHSRVGRVFYWKSHEDGALGSKYKLHC
NRSLNHRFLVFKNLNTF
Download sequence
Identical sequences T1ELE1
XP_009025861.1.102002 jgi|Helro1|154236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]