SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|158486 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|158486
Domain Number 1 Region: 112-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000398
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 155-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000656
Family EGF-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|158486
Sequence length 191
Sequence
MPKLFQILIYQGLVELVKCLEDDGGSINFEFFVKAYKEKASPRECCHCCNLGITISKLNL
PCGIQVKSIDQRCQSKLTFCCGTHHQPTTKKYKLVQQVTKPFAENFCGAYPEKLCSHICE
NVPGSFKCRCREGFELLSDNKNCKQIENFCGAYPEKLCSHICENVPGSFKCRCREGFELL
SDNKNCKQIGI
Download sequence
Identical sequences T1EMU8
XP_009008794.1.102002 jgi|Helro1|158486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]