SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|160059 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|160059
Domain Number 1 Region: 114-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000677
Family EGF-type module 0.02
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000144
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|160059
Sequence length 170
Sequence
MILSTSETIHTHLNEPATLKCYLSGQEKRHLSTGPSGDENKNYQLFWFHNGEIVYRGVKK
IKNGLILKKKIRRKDVGVYTCKAFNNGKVFATANSTVKVKPTPSVAGPGKFRGHTRSCDH
VDYCINGGTCTFIPKLNRKTCKCKKGFEGLRCEEKLTGQRSKQKFFVFKL
Download sequence
Identical sequences T1EPQ5
XP_009015328.1.102002 jgi|Helro1|160059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]