SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|166363 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|166363
Domain Number - Region: 132-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00763
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 75-163,207-227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0204
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|166363
Sequence length 497
Sequence
MSRRSHRVRKNLIKSQNSSVAPPATQPPVVPPVVSPVVPPAGGTQPPSGNGNATSGGGGS
GGDGGGGGLTMKLFSVCLGDENCTTVANSYCAPSKFNEDAKRCACKTGFSDWNTNGIYTC
ELIAQPNDPACKECTENEGICILVAGAAKCQCPASKSGDKCENTQGYLANNTNAQSLPTA
APPSVTNSTSSPVAPQEDNDVIDVKNGCPAGFYTLNLTLAINQTDHCGTVVKSDFQRFAT
GEYAGIGVVQPNGNDRGVQVTANLKMEILNAFGQPLSGDAVVVIGDQLKFKVTLVKDENY
KLAQVRRCYASSSFMLTDSFAEIRSLMSNGCPLSTEATKDSWYWTSSSDDNTYNLTTGLV
TMFKMITSENVYLYCNIRLCLGGYEDACPTLTKENCTTARRKRAVGTQLTRFKRAASLSP
TASSTVGSGIRVVDPGGIGQMSGTMTTIFAVVFSVLVAAVVVAVVVGALIMTRRKKNTGQ
HPERFAQPRVRTGNTKF
Download sequence
Identical sequences T1EY21
XP_009031549.1.102002 jgi|Helro1|166363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]