SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169460 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|169460
Domain Number 1 Region: 625-773
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-20
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 2 Region: 442-604
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000188
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 799-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000353
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 281-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000508
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169460
Sequence length 1107
Sequence
MNIQHINVVCSAIVDLFSEIRTLDSIERNDVGKQWFRHSGGTCSAHPLFDTSNDQHNTCL
VSIDICCLAELRKQKCLLGRKKALSGEPCRAMHEDSNECCNCCSLGLKSRETRNSCPKLP
RTKLFTCQCRESYIRCCNYGLQNKTKVLERSKYDIADPCLTSQHNCTWKERCLFKKSSKT
FICLPIASDANKQLNMDGTNVVTSSQKGKHKKHPHHHKSSSNNNNLRAGANDVTVAGELE
ISKSLDHSATNKRARGNEGEKRWSRSSKHQAACRAGFQFNEDTSTCQDINECLSHINPCK
ERSMCLNTEGSYECLSSMVHDSSSIDLRHVSLHNKGQHDSRYDIQVDNEEQFLKKKNKVL
QKHEHDDRYDSNGHYYNNGVVNDDHNSIAASSSSLSPSAAATTPNYINVHLYGKEHFNLN
NYENDKNDEVVVEKDGEKLNACGSGFVWSESSGRCQDVDECETIRCPSLHMSCRNNPGSY
LCVCNEGFKFNPRSRSCEDTDECQTVTHNCEAQETCVNTVGSFQCTSAMQQCAKGWLWDD
QLQQCTDINECEARQHNCKSDEMCQNSLGSFVCVRYECDAGFEFNEESKGCDDVDECEAG
RHTCSARQTCVNLVGSYVCRNDSACPTGYFHSVILNICQDVNECSDSSLHNCTKPNMLCQ
NRDGGFTCTCLAGYTYHQYSQICVDVDECLEAVQRGIHICPADSTCENKHGTFTCVCPPG
FFYDESTQTCIDFDECAIGLHGCDQACQNSWGSYYCTCRPGYVLNWDGRTCTAGHASPSL
QSYTDCPAGYTMNHLDGECYDTDECKEQRHTCPLETHMCVNTDGSFYCHPIVCPAGFHRL
MDGRMDGSRKYWMNVDRENSKDQEEHNFIETPEQVVSNRNDADNFFYQNDSPDVSSSSSS
SSSSRMKRVKRFLHSKSANKDDYSKNINSKNRKKLINFFYNISNNISSNNTKSNSASDSS
GVVCKKKKCGRSSRPSDVACRSNSTLSIQWNQMSLASIPQLSTATTIINIQPENVDRRLS
YEFLLVNTRLLSGKDNGNANDLFQIHKVSDWFGDKGEIYLLRSIRGAATYELEISLKTYL
KMYSNMKSGYLSEHLMHIIIYVSTLTL
Download sequence
Identical sequences T1F1Y9
jgi|Helro1|169460 XP_009013516.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]