SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169542 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|169542
Domain Number 1 Region: 251-364
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 667-776
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-28
Family Cadherin 0.00086
Further Details:      
 
Domain Number 3 Region: 559-665
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-27
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 137-251
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 460-563
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.00069
Further Details:      
 
Domain Number 6 Region: 36-142
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-21
Family Cadherin 0.0042
Further Details:      
 
Domain Number 7 Region: 357-459
Classification Level Classification E-value
Superfamily Cadherin-like 6e-21
Family Cadherin 0.00091
Further Details:      
 
Domain Number 8 Region: 1501-1694
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-19
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 9 Region: 764-884
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-18
Family Cadherin 0.0041
Further Details:      
 
Domain Number 10 Region: 1174-1191,1309-1392,1421-1454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-16
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 11 Region: 1146-1188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 12 Region: 876-963
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000785
Family Cadherin 0.0096
Further Details:      
 
Domain Number 13 Region: 1914-1952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|169542
Domain Number - Region: 1724-1753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00607
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169542
Sequence length 2426
Sequence
MTCFECCHLLEVAGTSAGCARDCYDAERKKRAVTNRPPLFNSTQYITNVPEELPPGVVLS
VGIFAVDPDDRDMGKITYSLFATKDQRSQSMFEINPADGKITTSQKLDRESMPVHYFKVV
ATDSGKPRRSSDVSLIIYVQDVNDHFPKFEQNLYTKIIFENVGVGSEVVTVHASDEDPDE
NGEIIYKIINNGDIENVFEIDPQLGILTTSAQLDREKKDFYELKVLAMDSSVQDIRLSST
VNVEITIQDENDNRPQFKNGSYQYKIKEDYDYIANPVIGIVDATDVDAGNNGLVRYSITS
GNSLNHFVIDPNDGTLSLVHPLDHEKVPSYRLSVKAQDSGQPAMSNNTVVHIDVLDVNDN
EPKFDMLAYQETIIENIPIGTTVLKVNAYDADSNLFGKINYTLLSDDFLPLEINDLGVIV
TMDEIDREQQAEYSFDVVACDNGETQKCSQASVRLTIRDLNDNAPKFEQKVYNSSISEES
PLGSLVETVRAIDVDEEANGRVTYKILSGNDRGSFSLITQMGYGTLSIAKSLNYKQQNQY
ILVICATDSLFNDTTTVYISITDANLNRPYFIGTPYHFKISEDTATGQVVFNVTASDLDS
GENARISYFLNVNDYFSISENTGEIKLKHSLDRETSSSHTLTVTATDHGRPPKTEYADVE
VVVLDANDNPPTFLKQFYKGSILEDANVGSSVVTVQARDADEGVNKRIKYSLINHLEEFK
IDSSLGIIRTIKDLDREKTHEYKLVVLASDGGKVSLTSSTTVTIDVLDVNDNAPVFERAN
LVFHVKENVPLSTLVGEINAHDSDEGANAVVEYFLLPEMDYEHFKLIPSPSANIATLETD
TELDFESDRNEFLLNVRARSNHLFTDALVKIIVTDVNDNIPIVNDFTVLYNNYKDNFNSG
MIGVVPARDPDVTDRLKFKFVQGNEGRLIHLNETSGMMRLNPRLNSDMPTNATLLLSVTD
GLNEVRVLCHIEVRLVTDEMLQNSVVLHLLQINQRLFLGPPYHAFVSALAAIVSTTADNI
YVIDVANDSLNSKKDNLVMNVTLAVKERVEYGRDIFYSGKVLRERIYTHMSLLQKLSLIQ
VLPFDDDDICHREPCLNFEDCHVTFEFSGATNMANNEFMFYRSVHTRSHFSCSCRRGFTG
KEYDNMCDMEVDLCYSSPCLNNATCLTVEAGHKCLCPFQYAGVHCEIDLTVTSSNKMLLT
GTSNSVTDLANIPCPAEQKNFCKHPSSCFLVKTCPLQTHRQQDHQEQTLPQCSYVACCLI
CDQTSCHDCANKPGYTKFCELRVRSFGGKTHGKDEDVDDDVDEIRSGRHHVGASYIAFPA
DGLLFYNGRYNKHHLDFIMLRMVGGQLKFSFSLGSHQVTTVHSHVENRVNTGRWIQLNII
YYNGTATLIVGEDCDAQLLLKKEAHLDEHSCAQQATQHLDGRCSDVTELCHRHLDLTGPF
YVGGLPDDDNLRSHLLQMLAVDGSENNQHEGHPVDVSDDDVEETAEVGSSEAQNFKRAKR
VCRSLWSDFICDCEDGFSGKTCNNSGQHGLPLIVYPWMVALHFRTTHRNGVLLAVQLNKL
HGNDDEQNADHHYDHLILQVKNGFLQCRMPFSSSSSSSPLLSMDVVSSGINDGQWHHVLV
TWNASCVTFQLDYSSAKVSYSLTDQLTGYRVKDISVGALLKGEGEQVVATEGFIGCFKLL
RVGGNMNMPFVERMLHDVTEGCHASNRCMEESGNVEVEGSVKKCNNATSVCVDVFDTLEC
VCDRGFQGENCKSVCDLGRHACQEGVTKCVQNSTTFYGYECVTENILLLQHQLTMQQQQQ
QQQMQQLLLKLQQLHSLKQHKSHVTFDVQHRFNLHQLLFYQRLLQRAQELQQTYQHRQHE
QQQQKCPPSWWGWPTCGPCNCQSNKGFSSNCDQKTGTCFCKANHYLRGSSCLPCDCYREG
SMSFQCDILSGQCPCRADIIGRQCDRCSDLTAEVTGDGCQAVVGACPRSFHSSVWWQRSP
FNATIVGPCPPRMVGMATRHCSHNQGWHDSDVTNCTSELFVDLEKVRLNHSTCLVHDWPL
KRTSLTLNDLNVTFKLLSSVTETNYFILLKWQLKHLQNLVNTLGRTLHADYFKLWTSINE
KEQNSTITLLMNVFRYVDNMVLNMPIIFTQPFDTVHKDIGGTDKLIMLGLDWVDGSRLPS
SSSSSSSSSSSDVITILPKFNNKVKQKEVVAMDTFVQLNFNSPDSHGGQQTLLTETIERP
ADHQMLKSQHGPSLYIGYIIFKSLAHILPKKYDDKFRRSHVTSSSVINSPVIYLSVYNAS
SSSSSSSLSGSLTIEFKSVPKNKYTKPRCISLWNGVWTNKFCKLLNDDDVSYSTCSCKHS
SAFAVMTEPTFDVTKTAGPFIMDVSLYVGIPLSLLFFLVAFVTFSFINFVSTRNISNAIN
MHLTGTLFITYLIFLIGIDKVEHRVI
Download sequence
Identical sequences T1F226
XP_009013584.1.102002 jgi|Helro1|169542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]