SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175178 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|175178
Domain Number - Region: 6-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175178
Sequence length 166
Sequence
MDPNLCGGPDDVCINTLGGYKCQTVKCPKSFILVKSRIFNTEFAICFYSFEFLFSSHDIF
ILLRFFGNKNFCMSVFCRKMQQTCPFNEHDCLIIQSFSINFIVLDTSKIITPMTLHVVKM
KMTRGSEMRYSLEVVSAIDPATGYDAGIDERIFYANKLILYDLFVT
Download sequence
Identical sequences T1F8Y9
XP_009020860.1.102002 jgi|Helro1|175178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]