SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175848 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|175848
Domain Number - Region: 118-170
Classification Level Classification E-value
Superfamily Cadherin-like 0.0361
Family Cadherin 0.0083
Further Details:      
 
Domain Number - Region: 43-154
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0366
Family BRCA2 helical domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175848
Sequence length 197
Sequence
MASLFQFRKTFILLLILLFVFSLHSIEKNILTSNEVPSSTDNKFQKFVHHYDRDYLNHHS
YNNHQHKHFVSKLKLKLSNLEKRKKKSITHSMINSEGEIDVFINETASGIIWSIDKKDQE
RYFFVNEVPDIFELHPTQGNIRLKDGAVLDYDRGQQKYVLQVGITRVDDLNCESFAPFLS
FSYLFIQIRFMTPGKFF
Download sequence
Identical sequences T1F9R8
XP_009021476.1.102002 jgi|Helro1|175848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]