SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|185115 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|185115
Domain Number 1 Region: 223-466
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.8e-55
Family Decarboxylase 0.00000134
Further Details:      
 
Domain Number 2 Region: 6-200
Classification Level Classification E-value
Superfamily PRTase-like 4.53e-36
Family Phosphoribosyltransferases (PRTases) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|185115
Sequence length 474
Sequence
MASNEDLVLRLYDVGAIKCGEFKLSSGLITPLYFDLRVIISYPEILVEVSDLLYEASKLV
SKPFKSICGVPYTALPIATLISAKHKIPMLLRRREAKEYGTKKAIEGHFEPGDICLVIED
VVTSGLSVYETILSLQSVGVHVSDAVVLLERSQGATNNLKMLGVNLHSIFTLPGMMEVLV
KHGKLEKAFTDRVLDFLINNQTTISIKQSANVSNGTHCMKTRDLMERAKLAKHEVSRKIF
EVMYQKQTNLCLSADVTNSKELLHLAESIGPYICVLKTHVDIIEDFDQSTCRNLLNIAHK
HNFVLFEDRKFADIGHTVSKQFTGGMFRISEWADVINAHPLPGPGIIKELKNANKRSGCL
LIGEMSTNGNLITPAYTKATLKMAEENDDFVIGFISTSRISHDPHFLHFTPGVSLDCKGD
GKGQQYLTPSEVVSKRGADILIVGRGITLAHDPVAAAKVYAQEGFSGYLAAVDV
Download sequence
Identical sequences T1FME8
jgi|Helro1|185115 XP_009027533.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]