SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|187787 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|187787
Domain Number 1 Region: 58-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.29e-33
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 265-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|187787
Sequence length 302
Sequence
MVGFVCFACFISFYLNAVSSKENLSCLVEGCDNEGRCLKVNEVVVEGGSGRREVHGSWMK
CNCPLPTGGPTCSQKLNTKLPRFHGDGYLKMFGLPSTAFQKINITLEIKADAHYGLLLFA
TSGSFSEKYYKDFMAVSLVSGHVQFRFDCGSGIVTIRSLNKILANNWNTLEIGRINKIGW
LKLNDGIKLMAKSKGQFSKISLKKEFYIGGHPNVSHFGEVALTTHGMVGCIRKIFMDGVK
LDMRKTDNIKGDALDGWNVDNCIENKCHATQCLNGGSCSYDELTDSIVCWCAVGWRGPRC
EI
Download sequence
Identical sequences T1FPD5
jgi|Helro1|187787 XP_009008780.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]