SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188055 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188055
Domain Number 1 Region: 552-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000173
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 2 Region: 782-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 736-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 258-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 658-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family Laminin-type module 0.0019
Further Details:      
 
Domain Number 6 Region: 114-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.069
Further Details:      
 
Domain Number 7 Region: 155-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 830-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 211-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|188055
Domain Number - Region: 515-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 613-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188055
Sequence length 1472
Sequence
MPAVRTAPLNNPSQVLCSEDESDISPLTDASVVFTTLSKRMRPKKIPFDELPALYEFTTA
SDIMISLIKMNTWGDEAFDEPRAQAQYFYAIKEINVGGRLILMGIRWVSSGSVGILRCYC
QHNTDGVDCEKCLPFYNDLPWKRGTMREPFECKPCNCNGLSDTCEFDADLYSQTGYGGRC
TDCRENTSGPHCEFCAVGFYKDHNYNRCFPCFCNIQGSVNEQCEMGGACLCKEGVHGEKC
DLCLPYHYNLTITGCDQCRCNYAGILEGTERLCDANSGQCMCKEFVQGQNCDECKPGYFG
LAYDNALGCTKCFCYGHSSECSLHDGYHIMEIKSSFRLGSDGWKGEAGSEDAVDVEHLSE
NNEITLGGADAAARSHYFVAPANFLGDIHQSHNLLLTFDLRISSSNRPVQPQINDIMIVG
GNGVTLQTPIYSQGNPIPNEYVQHYKFVLGEHQNYQWHPIGMSNVEFARVLFNVTAIKIK
AVYSDDGAGFLSNVVLQTVSSSSYTENEGSNVVAVEFCKCPEGYVGQFCESCAPGYKRHV
PHSGAFGVCVPCQCNGHSDHCEAESGQCMCEHSTTGTNCELCMDGYYGNAMNGTADDCTP
CGCPDGNKCIFMEATQEVVCLDCADGYGGLQCDVCDDGYYAHGEYDGNSGTPLLCKKCQC
NNNADPNDVAQCHYETGKCLKCLYNTTGDACQHCLPGFYGAAVDEPHGACYACDCYHIGT
LPEELEVERNNQIENNGYISNLLTCERDSGQCRCRDNVVGRRCDQCLDGTWNIASGEGCE
DCSCNLIGSFNSSCDVRTGQCHCKPGVGGAKCDQCLPYYYGFSDSGCSKCSCDFYGSFSL
ECHNDTGLCPCRHNYEGRACDQCAINRYNLKAGCVECPVCYGKVRDVYQGIQTDLNDIQR
LVLQAGNLTTVTLDDDDDPKLKDEVRQKVQKLLESVKSSEELDITLKLKNECESIKELKA
KLDRVDYKIFHLNSTLKNAKKEVDTAESLLESAEESIDEQRKKLKKEGDEELETIKRLKE
TSGRQSKEITSLASDARSHVTLLKQQKEVMENCSASFSNVTDEIHKIEIELARQQINHTE
QMKNLNAVFEHSKNLLKIVQKNSTDILAASTIIHNDTHFFLKEVYDTEMPKINVDELSSA
VADIEAEEETSLVDKLSAELSENKNEIERVRANVSDSTYQMGLYLEEYNDLKMQIELKFN
DANETEHSIKDTVTKSEETLNKLETFEAERQSKKKAADDAKTKLNDINLSVATSEKALTD
VSRDLWENNALNDVTASASFLLDVMESFNKTKKIYENNVETYMNSLNESEIMLAEHEVHF
AELDKAELLLNNFEEKNEEEYAKMEKIHIDVGETLITLEEDIEYVCKEGEENVNAVIHNL
NKLEPFNMANFKRCQDEMEKNTDKLRMTNFNERFITLKERGDHYKKMTEAYREEMTRLTN
EVNMLETISKAIPWTCVTTEELEVAPISWSNM
Download sequence
Identical sequences T1FPL0
jgi|Helro1|188055 XP_009009669.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]