SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188573 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188573
Domain Number 1 Region: 2402-2447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000984
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 2461-2511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188573
Sequence length 2623
Sequence
MAMNYLKSFFKLKILFEFAIKYFKGWTGSTGSTGSTGITGFTGSTGPKGFIGPQGNIGPM
GLTGFQGPTGATGFTGDTGQPGTVGFTGPMGPQGIPGNTGSPGATGTNGAQGSTGLRGDT
GGTGNTGVTGEIGNTGLIGSTGFLGLIGNTGRPGQVGQPGVAGRGGFTGETGATGPQGPI
GVTGSMGIQGATGLPGNVASSGAPGVRGQSGQQGQQGSTGQSGTPGTNGATGFTGYTGFT
GATGFKGQTGFTGNTGSTGQQGVIGTQGAFGATGNTGSIGINGPIGPSETIAFTNKNITQ
SNIKYLFRPTQTTSHSIFFTSLYTRLIDFFRKPVISLSKGDIGSPGSIGSTGDIGNPGVP
GNTGSPGSPGNTGSTGTTGNTGYTGYVGFTGFTGTSGSQGFTGRQGDTGFTGITGPQGST
GFVGFSGQPGVQGQPGLVGTTGNTGLQGSTGNTGAPGNTGLSGNPGENGDPGLSGLPGIQ
GSTGMMGVSGSTGNVGNTGFTGFTGSSGSTGQTGMIGFSGQPGFSGSVGATGVKGYTGNT
GITGSTGNVGDNGIQGPQGPIGFPGQNGLPGFSGSSGIKGSTGASGSVGQIGPNGIQGAT
GFTGNTGATGMKGDTGFAGQPGILGLQGATGNTGATGDPGGAGARGEQGGTGQPGQKGAT
GITGPFGPSGAPGQRGPNGDPGFSGNTGPTGTTGVKGSKGQTGPPGFIGPIGDTGSTGQT
GSMGTQGNPGTIGNTGSSGSPGNQGAPGIVGSTGSTGSSGFQGFSGSKGEPGLIGSSGPA
GNKGSTGFSGLIGFTGATGSTGLIGFSGSKGVNGSPGNTGASGTIGQTGQPGILGQQGAT
GFTGNTGFTGRSGDTGNSGVIGPDGLPGLPGIEGPRGSSGNFGQTGPFGQQGFTGLIGSP
GIKGATGSAGTGGSQGFTGATGFTGLQGDTGQNGLPGLLGFSGITGSTGSKGFPGQIGPT
GSPGSIGTKGQTGFQGSIGETGNSGSSGNPGQVGVPGAQGSTGLPGIIGSPGNIGVTGFT
GVQGSRGTQGYTGSTGSSGLQGDTGVMGSTGFTGFPGLPGAQGVTGQMGAQGNTGEQGDP
GNFGAKGQPGNTGSPGIFGFSGSTGLTGATGPQGEQGFTGPIGSIGSPGQTGLSGQQGTQ
GPKGITGDTGQSGFVGMQGFTGGTGNTGNSGSIGFQGPKGQLGWTGERGDTGATGATGFS
GTVGTQGLPGVMGYSGATGSTGVVGDTGFTGPSGVAGQSGASGTMGSTGFNGLPGFIGYT
GSTGASGVTGATGTTGPKGSKGGTGLTGPTGMTGQTGLSGPSGSVGLPGQPGLGGSPGSV
GTVGASGPRGPTGLNGNTGFTGFSGITGPTGPNGSPGNLGATGPPGSTGQVGATGNSGSF
GLQGFTGPRGLDGDSGFRGPTGTGGATGRFGDTGSSGNVGDTGSQGAPGWTGSSGNFGFT
GSSGVKGQKGSTGPSGPTGSSGNQGSVGNIGQDGVPGLPGPKGSQGPTGPIGNVGFPGTL
GFTGASGNTGSPGPIGFTGSTGSSGQSGIIGSMGLTGDDGNVGKFGPTGNTGESGSPGSP
GIIGATGVQGPRGQPGANGQPGASGAQGPAGVIGVMGSYGDTGSSGEQGIPGSIGFTGAN
GFTGITGQPGLLGSKGYPGYTGNTGSPGFTGFQGDVGFPGIKGQPGFDGIIGPKGQNGNP
GPSGPFGLAGLPGPTGITGFTGLVGNTGNTGITGPSGDTGNSGTVGLQGFTGATGPLGAT
GPSGRPGFGATPGRTGMIGATGQTGYTGNTGAIGYTGQKGKDGAPGLLGNTGSFGAQGDT
GFEGDVGPQGASGQSGQPGIQGGPGQMGATGFTGNSGAIGAPGSMGATGFTGSNGNTGFT
GYTGQLGPVGTNGKPGPTGNQGNDGSRGQQGFTGPNGLPGISGSSGVKGDIGAPGSQGSD
GPPGDNGPQGLQGITGNSGLPGLPGSKGSLGPSGYTGPTGSIGFGGPPGDAGNTGFTGAT
GYTGFTGARGLSGSDGSPGLAGDAGPQGATGAIGNAGSTGFTGFIGDPGLRGPNGFKGNT
GSSGLVGFTGYPGVPGTGGFTGFTGGTGFTGGIGFTGVTGNTGYTGQIGATGPKGNNGLS
GQIGPTGSTGNTGLKGLPGSPGFDGPRGITGASGSVGAPGFNGVDGSNGAVGASGLQGAT
GPNGMVGPVGSTGKVGNVGNTGQIGAVGGKGPIGSQGQSGIPGVQGAAGTPGDTGTSGFV
GMTGSTGVGGKTGDAGNTGSTGFLGPVGDSGIIGQMGNSGSQGLPGLSGPVGPTGQTGLA
GQVGNTGYTGATGLPGRTGVFGDTGNIGYTGATGSTGKPGFVGASGVPGATGSTGSTGGP
GMDSTNKLLNKDAVKIWCDQLNCDQFCEVAQLSYPNGSISYQPYCVCTVSYMKIRVAGGF
KCTTLNECNYNNGFCEQICVDRMDGYQCSCRPGFTLGANKKSCTSTGGSSTVLINYTPIH
CENLNGGCSDYCIKGTNGAADVCACPKGYALSMNNRDCIDVDECALNQSICPARLTCINS
LGGYICVTATLEQVVTQQQLQNMNDVLDKLPAINESMTSAKLNTQQLSSSYWGLIAFNTF
VTIAITALIALACKKWKQLSNEENDYLNNFDSLSRTQSIGNIK
Download sequence
Identical sequences T1FQ51
XP_009019505.1.102002 jgi|Helro1|188573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]