SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189201 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189201
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily vWA-like 8.22e-37
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 190-287
Classification Level Classification E-value
Superfamily Integrin domains 5.07e-16
Family Integrin domains 0.0029
Further Details:      
 
Domain Number 3 Region: 432-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Integrin beta EGF-like domains 0.0033
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189201
Domain Number - Region: 476-549
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000157
Family Integrin beta tail domain 0.0058
Further Details:      
 
Domain Number - Region: 404-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000949
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number - Region: 294-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189201
Sequence length 619
Sequence
MAKDYPVEIYFLIDSSFTMESYKEDLSKAVDQLVSRLHSISNNVKLGLGVKIMTPQKDGS
MQLHKLYSARLTGFFLNLKTFDLNFDKEHIGWSEKARKMIIVLTDAKFHTAGDGKLAGIT
EPNDLQCHLNSTGFYTQDREQDYPSVGQLIHLFETSQIHLMTFVKGFQDEYKRLTKYLPN
SIVGNAFSDSNNMYQFIVENYENIHSSVNLQFIQNDKVDIQMRSQCNTDNKWIKGGHCRN
VKIGQKVSFELTISTNSCDPQTIYIHPAGLHEKVKINIQPICDCRCQINLQRNHSVCNMH
GDAVCGSCQCHEGYYGDKCQCFTERSALQLVRCVRTEAHVTVECVRANQSGQVIHLNFSP
APNASVTTMIVNKYRDECATVGSNNLPRTHSNDDRRCKINLVYYSGKGTCHCGKCQCRPG
FSGSACDCPTSNKTCLASNGDLCNGVGECNCGVCQCAKDRPFIGDTCEECPTCSDDVCQE
HEFCASCFFEPDDHICHSECSTNIHPVNQLPEMSANQIFCESHTTKCTTKFIYDLRSSSI
VLQTKKECVSELMIIGSVVGGVAMIGVIMLVVWKVVVTVHDNKEYKKFEMERKIAKWATA
SNPLYKSAVTKFINPAFRE
Download sequence
Identical sequences T1FQS2
jgi|Helro1|189201 XP_009025516.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]