SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193483 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193483
Domain Number 1 Region: 212-459
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.99e-20
Family Extended AAA-ATPase domain 0.024
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|193483
Domain Number - Region: 698-816
Classification Level Classification E-value
Superfamily vWA-like 0.000578
Family Integrin A (or I) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193483
Sequence length 822
Sequence
MTQFVDSTINLLRIHPSFRLVGLSEPPNSNVGRANSKQQSHWLTSELLTSFFFHHIKQME
FEDELNVIKREVKDITRMLPVMQFTNNIRNAHDNQLRSVSSSLSTRQLLRIARRLNVYGA
DDDVHHLVSKACLARFLPRLTKMMFEDELVKLGIVPTSPSSSISPSSSSSSSSSSSYDKA
DDTDLDEMITCEVSGGVLRIGCVQAPVHPSNHPTKVPDILFYDNYQHLKVMEDMLKDFLL
GEHLLLIGNQGVGKNKIADRFLQLLNKPREYIQLHRDTTVQSLTVQPKIVDGVLSYDDSP
LVKAVKSGSVLVVDEADKAPTNVTCILKGLVQVGEMHLSDGRRIVRGDSRLTPSQSTIPM
HRDFRMIILANRPGFPFLGNDFFAAVGDAFSTHAVDNPSAASQLNMLKKYAPSADETTLR
QVAELFDELRSLSDQGVINHPFSAREAVAVAKHLQMFPNDGLMTAVENVFDFDAYDPDLT
RVIHKVMRKHGLPVGGHVGNIHLAKELSIPPMTYKCQLTTKNLKNSFNLKAQRLKLDDFQ
QRSTHFNEVTSTWHIPIFQGSDVTMVTVAKADQHYQQQQSLDNTDQLNSDIIHAVTSDPL
TLCSIDLLRRSTTLIDLHPQQSRRNRFFSQLNVAALQAPLNHGVVLHDENGYEEKIRYDI
HGHSGEGPKFTFVRCGGSDGCGGGGNGGGGEGVSPPVNNKQRLDVVMSLYAHSQFCLSGD
HTLEATKMAVEEVAAMSDVDDRFVIVLSDANLERYGISARRLARLLTSKDNVNSYAIFIG
SLGDQAERLTNELPAGHSFICMDNKQLPIILQQIFTSAMLRP
Download sequence
Identical sequences T1FV15
jgi|Helro1|193483 XP_009026120.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]