SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194108 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194108
Domain Number 1 Region: 303-432
Classification Level Classification E-value
Superfamily Plus3-like 2.62e-44
Family Plus3 0.00000342
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|194108
Domain Number - Region: 183-232
Classification Level Classification E-value
Superfamily MIT domain-like 0.0693
Family MIT domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194108
Sequence length 665
Sequence
MSRKAKSEAFINSSDEDDSDDLDEELKLLANKKTPNLARLSESESSSSDSDAEWSSGNKL
KRKKKNGRPESKKRKVDSGSVESEPEEGEVSDSESEGMDSEEEFDDGLDDNLIRDEEDKK
KLEMMTEKEREQELFNRIEKREALKTRFAIEKKLREARKKDKSKGKTSSQSSGASANLKS
ASQTRKKLIEDNKKFTKTTNALQDLRARREEKKKQAEQIQQQKEQEEREKESKKKLKTSD
IYSDDEKDDAKSAVEQEEEEKRRSSSSSSSSSSSSSSSEAEEDDDDEDESSEIKRKKMQS
VSTKEELNSIRLSRHKMEKWCHMPFFNKTVIGGFVKIGIGNHEGRPIYRVAQVVEVVETG
KVYQLGTTRTNKGLKLRHGKSDRVYRLEFVSNNDYTESEFSKWMQTMSDDKCPLPTLYDL
ELKLKDIKDALNYKFNETDVDQIVAEKQKFKKNPHNYAMKKTDLMKQHEIAIQNGDREKE
KDIKRQLDELEERAIELDKKRTNNISSISYINQRNRMRNLEDAVEASKREVAEMKTAKAD
PFTRRQCRPTLVTKARDLEGEKLKRLRMLESDDVDARAGADLTNGAKDPKTASSLSSASS
ATKPDQPEHVVDDLFKIHNFDVVIDIGEHEVPLAAAPRLEDPLRHVPNNRRSLNLDDYKK
KRGLI
Download sequence
Identical sequences T1FVP4
jgi|Helro1|194108 XP_009028561.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]