SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194961 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194961
Domain Number 1 Region: 278-478
Classification Level Classification E-value
Superfamily vWA-like 1.59e-36
Family Integrin A (or I) domain 0.0022
Further Details:      
 
Domain Number 2 Region: 123-273
Classification Level Classification E-value
Superfamily vWA-like 9.05e-31
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 85-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000272
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|194961
Domain Number - Region: 19-73
Classification Level Classification E-value
Superfamily vWA-like 0.00289
Family Integrin A (or I) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194961
Sequence length 499
Sequence
MSSNFTATWQEAVRTRVANVKIVGVGQDIDMNELVAVATSAAPSTPQSNVFVASNYTTLS
DQLTNKISSAICAEFHVNELSVMLYPTDFKYCNSTSCMKGQCIEEFGGFSCKCPSTSTGT
YCERDKTRIGIIVYSDDAELSIRMNDYWIMQDLITAFKRVLYKGQKTNTASALNLLYTQA
FTSFNGDRSDVPNVAVIVTDGNSNVNPSSTVDEAIACRLAGIRLVTASIGDSVNPAEINN
IASFPLQFNTFNVSNYTLFDKLVHLVVQATCDSFNECLSNTCQPRGTCVNLFHSYQCRCQ
RFYAGLNCERYCTVRSDVVIVLDVSGSIGYLEDWYNMLISFAREIINGLDVDNDVARVAI
VAYSTDVIKTIYFNQYIGNRTKLLESLNFYHDGGTTNTQAALYTVANSVFDSNRGYRGND
NGVLKSVILLSDGESNVQAENTVPAANNLKRLGARVYSVVVGTDINYAEMERVSSNATLY
TYRMPYVSDVVRVASKLLT
Download sequence
Identical sequences T1FWL8
jgi|Helro1|194961 XP_009011576.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]