SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|62664 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|62664
Domain Number 1 Region: 738-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000761
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 2 Region: 929-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 3 Region: 786-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 310-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 247-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000482
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 6 Region: 484-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000373
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 7 Region: 1033-1074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 882-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000578
Family Laminin-type module 0.064
Further Details:      
 
Domain Number 9 Region: 981-1030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000227
Family Laminin-type module 0.0042
Further Details:      
 
Domain Number 10 Region: 398-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 433-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 12 Region: 1081-1128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 832-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|62664
Sequence length 1151
Sequence
CGESVCEPSYGNLLIGREKNLTASSTCGTKGQEKYCVVSHLDKDKPNNQKARTFKNCFIC
DSRQPYSVDNKKSHLIENVLQTKELDKNKWWQSKYGEHSVYVQFDLEAEFHFLYLHFQCK
TLLPAAMLVERSNNFGRTWRVDRYFSEDCERDFPRVPTYSSDFRVPYCTNEFSESPNKLN
REVLLTILPPDFKDPNPYREEILDILRMTNIRINFTRLHMLGDQYLSLDAKRNYYYTIYN
MVVRGRCSCYGHSNKCIPLPWQKNITDAVYGQCECTHHTTGYNCERCEDFYQDLPWRPRS
SDNLNECKRCECHNHSNKCHFDPAIFILSHNKSGGVCDDCQHNTMGQNCEICKANYYRNP
RVSINHPDACIHCDCDPRGSEVLGGCESTGDAELGIEAGRCNCKKFVTGHRCDTCLPGYW
NLDERNPHGCEPCACNAYGTVAGHQCEYQAGECRCKRFVTGRTCDSCLPGYWNFGRDEEG
CTACNCDIGGAYDSQCNARTGQCRCRPNIIGQHCNHVARDHYYAFLDWLLYEAEEASERG
VIIYKDRLSGGGYVTWTGVGYTKVMGGSSLTFVVDNIPHSMEYDFLLRHDSKQVLHPWEG
LKMTIERSGRANERSGCANTTPQDYNKVFTIQPDTTHSFVRPGTCLEKGVRYTITFKFPA
QRYALDGKESHIFIDSLVLLPGSTGHPLNQKPEVYEQFKRQRCMETYYSPVRQFRESDIC
RRLVFSSSVAIHDGAKSCDCDLHGSFSPSCEVAGGQCKCKPNVIGRRCDKCAPGFYGLTY
TGCMACDCHSHGSMSPVCDQRTGQCPCNTNSFGLKCSSCQRGFWGFPNCRKCSCNGRADE
CDQVTGKCIGCRSNSGGPYCDGCADGYYGDLKTGCQRCPCEHGGSCRWDPRSNQVVCDCP
TGYTGPRCDRCAENFYGDPTYPDGTCQMCKCNNNIDPAVPGSCDSHTGQCTKCLYNTEGG
SCERCKAGYYGDALSQNCKACVCNVLGTHAHLRNDCDRVTGQCHCLSNVFGRSCDQCGEN
FWKLADGRGCEPCNCDPYGSLSQKCNDIDGQCQCRRDFGGRQCNQCAENFWGDPRSSCKE
CMCDVGGSVSQQCDRHTGACTCNPGVTGHLCDRCARGTTGSLPHCKPCGPCYDGWLKLIG
DITSSSLNSLK
Download sequence
Identical sequences T1FX33
jgi|Helro1|62664 XP_009009407.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]