SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|74247 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|74247
Domain Number 1 Region: 4-217
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.06e-64
Family D-ribulose-5-phosphate 3-epimerase 0.00000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|74247
Sequence length 227
Sequence
MSRSLIGPSILNSNLSKLADECKRLLLAGADYLHLDVMDGHFVPNLTFGHPVVACLRPNF
PGVLFDVHMMVSNPEQWVEPMSKAGANSYTFHVEATNDVPNCIKLVKEHKMKVGIAIKPK
TPVDCILEYLNCVNLVLVMTVEPGFGGQKFMADMMTKVVEKIRSLAPDLDIQVDGGVCLD
NIELCAKSGANVIVSGSALVNSSDPQSAIQNMKTAVDKEIERMRERK
Download sequence
Identical sequences T1G1N8
XP_009012782.1.102002 jgi|Helro1|74247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]