SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|79481 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|79481
Domain Number 1 Region: 24-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000176
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|79481
Domain Number - Region: 70-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0348
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|79481
Sequence length 111
Sequence
MRPSDGPDDGSWMTLAGRRECVACSCNGHSDQCDPVDGVCLNCQHNTEGSNCEICSPGYY
GDATSGEPYGCLQCPCLNLDPLQNNIITCYQRERDVVCLCPEGHEGDRCER
Download sequence
Identical sequences T1G3P3
XP_009017784.1.102002 jgi|Helro1|79481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]