SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|83142 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|83142
Domain Number 1 Region: 456-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 2 Region: 411-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 281-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 4 Region: 340-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.039
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|83142
Domain Number - Region: 133-236
Classification Level Classification E-value
Superfamily Sialidases 0.00194
Family Sialidases (neuraminidases) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|83142
Sequence length 501
Sequence
MLIVTVFIISLLRTIESQQDNTGSEQYIPQSDTQNWAAGKKVVATATCGENVSEPELFCK
LTGANPDLEGDLSDHQVIQGQYCDYCNPRNPSQTHSAEFVTDGTERWWQSPPLSRGLQYN
EVNLTIDLAQELHVGYVYITMGNSPRPRVFALERSKDNGKTWTPWQFFADSESECQHHFG
DYEYSENLDADDSVLCTTKFSDVKPLEGGEIYVSLINNRPSAERFQESKVLKEWTKATNI
RLRLLRVNTLLGRLMAINQQDVTVTRRYFYSIKGISVGGSCICNGHARECTKPDPKNHLK
KLCECQHNTCGDHCDQCCYPFIQKKWRPAETHSNNECERCQCNGHSDTCYYSEEVAQNKS
SLDIYGNYEGGGVCTNCQHNTEGCINCQKCRRGYYKRANVLMNARNACAKCNCDTIFSSG
ACDDETGRCQCKPEFSGPDCRRCNEGYFGYPRCQPCRCHVNGTRDKVCDPSGGVCPCKEN
YDGPNCDQCAQGFYNFPECKR
Download sequence
Identical sequences T1G510
jgi|Helro1|83142 XP_009021397.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]