SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|83699 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|83699
Domain Number 1 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000299
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 36-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000305
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 3 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000682
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 4 Region: 79-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000717
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|83699
Sequence length 241
Sequence
CAINPCKNGGKCRSHLNQYYCVCDDSFTKRDCSKQTDLCNPNPCQNNGDCVDGLHDYTCI
CSKGHGGKNCQHEKRQCIGFDRCKNGGRCMEEINDFSCKCLSGFCGKDCSKNGNSCDPNP
CKNKGTCTDGMRSYACTCMDGYTGVNCEKGVVRFILFVHLPVFLLKLFYMSVYLFTCLTA
FLSVCLTVYIYFYLSIIYLSVGLSDCLSFCPFADLSNHPSIYPSISFIYFKIKLTKTDLF
I
Download sequence
Identical sequences T1G593
XP_009021926.1.102002 jgi|Helro1|83699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]