SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|85694 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|85694
Domain Number 1 Region: 112-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000043
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 2 Region: 35-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000947
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 3 Region: 190-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000395
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 153-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000516
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 74-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 6 Region: 3-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|85694
Sequence length 229
Sequence
GDDPCLNGGLCIPFFSGGYQCKCPMRFAGEICKNSNSCEKNPCKNGGVCLPLNATDYRCD
CMSTAFVGKNCEYADPCGMNPCLNGGICKSFGSGSYRCDCPSLFSGNQCQTIDVCINNPC
LNGGVCNHSEDNGENFTCSCPDSFFGEHCEYQDFCGSNPCLNGGVCKNLVPGGFRCECSG
SFSGKHCEKTNVCEPNPCFNGGSCFPTNSTDYECHCSGPFRGRNCEIQG
Download sequence
Identical sequences T1G618
XP_009024632.1.102002 jgi|Helro1|85694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]