SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|86708 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|86708
Domain Number 1 Region: 423-553
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000155
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 631-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000279
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 3 Region: 358-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000306
Family EGF-type module 0.005
Further Details:      
 
Domain Number 4 Region: 245-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000928
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 5 Region: 323-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 159-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 549-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000625
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 123-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000671
Family EGF-type module 0.027
Further Details:      
 
Domain Number 9 Region: 201-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000929
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 3-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 593-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 280-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000274
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 44-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000286
Family EGF-type module 0.034
Further Details:      
 
Domain Number 14 Region: 80-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000353
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|86708
Sequence length 688
Sequence
CENYDPCSMRPCVNNGVCLSNGPGVKFTCNCLQPFYGDRCQFRDPCFQNPCYNAVNSNTN
PMNFTCLCQPGFIGNLCQYFNACLLNPCQNLAICYSNVIDTLSAFTCLCTVGRFGATCDR
FDPCSSAPCLFGATCFNYTDTNFTCKCANGYFGPTCASRDPCTSNPCKNSAFCSMLFSSH
EANSGFRCLCRDGFFGLLCDKFDACTLSPCLNSGSCRMDDSGESIVNNYKCQCSAGLTGA
DCDTEVNECSSTPCLYGGTCIDGLNYFRCNCTSDRTGVRCEIALNSCQAIPCASGATCLD
RASDGYICICPPTKTGLQCSEDSHPCSPNPCFNNATCLASTSSCTCPPGFTGANCEMDID
ECQSRPCLNSGTCQNNVNSFKCICLPGYVGSICDVKLDRCQSNPCLNGANCSSTLDGGFT
CACNTDWTGVRCEISVEACRSSPCRNSGRCLNTIAGYMCICPAGYQGDQCHYEIDECLSG
PCINGATCVNLVGAFKCLCMPGYTSNKCEVEIDECLSSPCSPGSTCVNLVNSFRCTCQTG
STGVTCYDDVNECSSTIGQELCFNGGTCVNLFRSGYKCDCMPGYMGGDCRSVIDSCLSQP
CQYNSTCKPGIGFFKCICTPGFKAGDNCGVEINECLSNPCSNNGTCLDDVNSYKCSCTDG
YLGTYCQFVGKCFRTYQIPAVDYLFVCF
Download sequence
Identical sequences T1G6F9
XP_009026317.1.102002 jgi|Helro1|86708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]