SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|88819 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|88819
Domain Number 1 Region: 141-298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000628
Family Growth factor receptor domain 0.0096
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|88819
Domain Number - Region: 110-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00272
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|88819
Sequence length 317
Sequence
FLKGLLSTSKSNFGGGNTKWEETNLGSYAFSETRFLEIIEDICSGQSQQCHQMLEKYEDV
LENWWKNVFAKGTKSDLRDFFCIRRTKVCCPHGTYGPDCRDCKPDRKNPCNGNGICDGDG
THSGTGKCSCHPGYEGELCGKCSDGYYARKQRNVAADGDAAANNACSQCGGPDVESCTAC
ASRYFKNNKGICNLDECTMPGFRLRCALDEYCVNSIGSYKCSTCHPTCLSCHGPGRDNCK
QCKDGYHIEEGACVDTDECLKSSEVCPGTSRKCINLPGSYRCECVVGFKDHGGVCVPKSQ
SRNVLVVVVVVVAGGGV
Download sequence
Identical sequences T1G768
XP_009028535.1.102002 jgi|Helro1|88819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]