SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|95235 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|95235
Domain Number 1 Region: 36-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|95235
Domain Number - Region: 11-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00407
Family EGF-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|95235
Sequence length 210
Sequence
TIPTACDTAVSTCVDKSSYYVCDCISGYQHPPNNDTYCADVDECFESQHNCSKPLATCLN
TKGSFVCICPYGYVQVNNNCLEEDECTTYANACDNRTSTCVNKVGTYSCNCLSGFYSKNP
WTCDDIDECALNLHNCSNPTEICVNTAGSFVCQCSPGYQRFNNVCSVSGERNLLFAFIGV
FGAVILTLIGVFASCAASYQSQLAKANLSE
Download sequence
Identical sequences T1G952
XP_009025257.1.102002 jgi|Helro1|95235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]