SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|107639 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|107639
Domain Number 1 Region: 201-341
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000962
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|107639
Domain Number - Region: 96-121
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0326
Family Chromo domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|107639
Sequence length 390
Sequence
MRYQGDPIRDLILKHIGEHEASKRLVLKVDSVSQDVSGLQQLIKANSLRAAVDLTGQLLT
ACGQGARRANQISTNTPYSLQLWFVRLSLLARLNLYGPAECEWEPFGNLSNPDIFYEFYQ
STFPNRKGSMVPFGMRILHAELPQHLGRCQQSLDRLYHMLSIVNKIQENLLSDKDEYGLP
SCEITVSEREECKLIWRKREARLLYCISNCLLSMKDYLNCLATYRSLLTKDVEHKSDIHE
AMGRVYLQLGDVERAEMNFSLIQPSHFRNEQQYLSAKFLNRGFIDMSLGRYAEAYSSFKH
LFEQDKNNLTALNNMCVCALYLGRLREALRQLELIIYTSPKTFLQEVVVLNLCTLYELES
SRAIVKKQNLLRLIGQHRGTGFNVSCLKMA
Download sequence
Identical sequences T1EEB8
XP_009025783.1.102002 jgi|Helro1|107639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]