SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|114226 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|114226
Domain Number 1 Region: 219-409,452-474
Classification Level Classification E-value
Superfamily TPR-like 9.86e-29
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|114226
Domain Number - Region: 83-137
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00628
Family Myosin rod fragments 0.0057
Further Details:      
 
Domain Number - Region: 10-110
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.034
Family Hemolysin E (HlyE, ClyA, SheA) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|114226
Sequence length 553
Sequence
MGALSQEEIISNTRTVIQGLDSLRLEHHQLLNNLLSMNGIADKNFHNINNNIVEEKINML
KKAIEAIDLAIGEAQMMVSFAGHMETIESEKQKLRAQVRRLCQENSWLRDELSMTQQKLQ
HSEQKCAQLEEQKTHLEFMAAMKRYDSNAVRNESETQNDASSLHVDLGFPEEDEENQAEA
VFPNTSTSQSSIVGGGYEVPARLRTLHNLVIQYASQGRYEVAVPLCRQALDDLEKTSGPD
HPDVATMLNILALVYRDQGKYKDAANMLNDALQIREKSLGSDHPAVAATLNNLAVLYGKR
GKYKEAEPLCKRALVIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALDIYQ
SKVNGPDDNNVDKTKNNLASAYLKQGKFKQAEMLYKEILTKAHEKEFGLSGDVTKPIWQY
AEEQDDSKGRPRDMNTMKEYDNWQRSLGPNGMTVTTTLKNLGALYRRQGKHGAAETIEEF
LNKSRQQQQQQNGYDSGRDVRSKQSTTGHMRESSRSGGGVSGGAGAGRSRPVSMDGSFYD
KMNNSSDRPEQQQ
Download sequence
Identical sequences T1EG03
jgi|Helro1|114226 XP_009024498.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]