SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|115114 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|115114
Domain Number 1 Region: 379-415,455-536
Classification Level Classification E-value
Superfamily TPR-like 0.0000000101
Family Tetratricopeptide repeat (TPR) 0.057
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|115114
Domain Number - Region: 82-144,371-431
Classification Level Classification E-value
Superfamily TPR-like 0.000159
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|115114
Sequence length 599
Sequence
MSNNSNNLVVNYDESQQLGSWYPSLLGLAEYFRTLNPPNVKFCVQCLQAVFNFSPPAFIQ
ARTYLQIGTVLSKGTKNIQLSLSHLDRAWTISQTCHSADDIKFEAACLSAQLLCQQGQLM
EAKNFLRRATEQSLHAPFWHSRMLFQLAQLEMEENDHKASTLTLSAGFEYATLRESQYMR
LLFLLSKTMVQLIDRKLSEVQQSLSQCRVIIEQWQLAGNQIHVKNLIEVFFLVIQVSQYL
LVGQVKSVKPMLKQLQHTIQNITTTYNDEEIMKTLNPIELFHWLPKEQLCVLVYLVTVMH
SMQAGYTDKAQKYTEKALLQIDKLKSSANPTVLSLQAMLLEHIVMCGLITGHKSVALQQI
LQLCMVCHSNSTVSKRHSPYIHVLLGLYAMSINSMEQAEAQFKVALVSPDPELHMFVSLN
MGLVYLRMNRHIELNALLESIEAGRINTVSQCMKASTFYIQGLQAFFQSKHQEAKRCLRE
ALRLANTEDLNRLTACLLVLFGHVLLSIGNNQEALNMISPALQLANKIPDLQVQLWATAV
LKDLYRQLGSPQLEADSFRLHDSYSQTLLEDHFRATQSAEHQLVHWTEGPCPFFAPQNS
Download sequence
Identical sequences T1EG67
XP_009027170.1.102002 jgi|Helro1|115114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]