SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|116733 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|116733
Domain Number 1 Region: 529-713
Classification Level Classification E-value
Superfamily TPR-like 1.9e-31
Family Tetratricopeptide repeat (TPR) 0.0044
Further Details:      
 
Domain Number 2 Region: 659-825
Classification Level Classification E-value
Superfamily TPR-like 4.17e-19
Family Tetratricopeptide repeat (TPR) 0.0074
Further Details:      
 
Domain Number 3 Region: 430-547
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000137
Family Tetratricopeptide repeat (TPR) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|116733
Sequence length 843
Sequence
MQRYHYALIIICVLAACYHNSLKCGFVFDDVSAVRDNKDLRPSTPLINLLQNDFWGTPMD
KDRSHKSYRPLCVFTFRLNYLFGGLEPFGYHLVNVVLHAVVSLQMFYFGLSLNMEVVSSF
MASILFAVHPVHVEAVTGVVGRAELLSSIFFFLVLKLFHSSAESNRRNELVQSYVKLLCS
IILVAMATLSKEQGITVVAVCCVHELVIIRKLNLKEIVTVINNVLTFNFKKLPPWFLNTL
CRCGFLVGATCLLLYARIKVMGAQLPVFTKFDNPGAAADQPQRFLTHNYMLPINMWLLIY
PSWLCCDWTMGTIPIIESFSDLRNLATLAFYCGFAILIWCFYRTDETSYNVLFLSLLVFP
FIPASNLFFPVGFVVAERILYMPSIGFCYLAVSGFDTLSKHFKNKIPHTSAILKIIFTCI
VILFSVRTYVRNEDWKDEYSLFMSGVRINQANAKLFNNVGHALENEKKFEEALKFFLKAA
EIQPDDIGAHINVGRTYTTLKKDDEAEISYRKALALLPPVKPGQSYMTRLAPSHLNVFIN
LGNLLIKNVSRLNEVDVLLKTAISMRNDFVQAYINRGDVLMRLGRVDEARSQYVEALKHE
PNNPDLYYNLGVVSIEMNQTDEAYSYFDRALLYDPDHKQSLLNSAIMLQGINDPTLRSKA
EERLLRLKEIDPSDEKVHFNLGMLYTDALRYNDARSSFKRAIQLMPSFRSALFNLALLLA
NDMKMHLEAVPVLEQLLQHYPSHTNGLILLGDISITHLKDLNRAQTCFEKILQQDPNNIQ
ALHNLCVVHSERGDLLKAEKCLVKVLSLAPSEDYIKRHLVIIRQKIQSLMKKGKNEKVNE
GKR
Download sequence
Identical sequences T1EGH4
jgi|Helro1|116733 XP_009032031.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]