SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|120372 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|120372
Domain Number 1 Region: 22-118,311-367,560-715
Classification Level Classification E-value
Superfamily TPR-like 1.62e-17
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|120372
Domain Number - Region: 80-379
Classification Level Classification E-value
Superfamily TPR-like 0.0106
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|120372
Sequence length 716
Sequence
RTRRPPQKLKRVLAGLMGEANMKYASGMFEEAVKISMEVICNAPNAPDPYHLLSMIYDDL
GQLDKSLQHSLVAAQLSKGNVEEWLSVADKAIALNNLKLAVFCYERACKFDLSNEKLWKD
KCELMERASCEKKKILDSYKHLIGLMRPSSIFIDLVRRTFNEYHTLGEDKKAAEVMRIAL
NNYPWLVTPSDINLLIDVYFLDKNYVDSLSLLEKHCGVNITRSNDSISEVVTNNLPVDLL
AKLLICLIHLKECNVLEPNLTSLCSENCDEVGDLFLDVSEAFIAEKDYAHAERLLKLLLN
SQNYNLAAVWLRFAECLKFLNKSDEAILAFSKVVEMASDHIEARMCLSNLYQQLGRYDEA
IYVLQPISNCGDLSDCHLQLLLKKCNVLHQQNKILDFVDFAFKVLKMCAEQIFVQKCHTE
VSNRVVCIRQLAYHHALNLIDKSCELKEIASLSQLSNEIWDLFMKLCEELCRLKLYEKLD
KICTLMVICPVFLHDTVRSQELEFMCLISGLLSRNAYFAYSIIRHKLIKVLDDNNAWNIF
GQVIAVSQDIRHNRFCIRFAMKHPNNVALCILNGHNALAAGSYKHSLGEYFACLKSDPKN
PFYYMVIGITYVHLVSQKFSSHRHMLTVQACAFLFNYLKLRGECQESFYNIGRAMHQIGL
QFLAVGFYERALKCRPAVDSPDFDLTREIAFNLYIIYMSTKSYQLASYILEKYLQI
Download sequence
Identical sequences T1EGP8
XP_009026856.1.102002 jgi|Helro1|120372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]