SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|139427 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|139427
Domain Number 1 Region: 95-342
Classification Level Classification E-value
Superfamily vWA-like 6.67e-80
Family Integrin A (or I) domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 352-429
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-16
Family Integrin domains 0.0014
Further Details:      
 
Domain Number 3 Region: 605-691
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000222
Family Integrin beta tail domain 0.003
Further Details:      
 
Domain Number 4 Region: 2-45
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000392
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 562-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Integrin beta EGF-like domains 0.0097
Further Details:      
 
Domain Number 6 Region: 518-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family Integrin beta EGF-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|139427
Domain Number - Region: 482-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family Integrin beta EGF-like domains 0.024
Further Details:      
 
Domain Number - Region: 439-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 59-114
Classification Level Classification E-value
Superfamily Integrin domains 0.0105
Family Integrin domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|139427
Sequence length 760
Sequence
QKTCGECMAAGSPCGWCSQLNYEFLERCDLKDNLLRNKCDPSQIMTVQSSIYLNENKPPM
DSDSVKNAIQLSPQKVTIKLRPNDPFTFNVHFRQAENYPVDLYFLMDLSQSMADDKVKLA
SLGDALATEMNKITKDFKLGFGSFVDKKTMPYVSTVPAKLENPCDEMQDCAAPYGFRNDL
PLDIDTSRFKAKVNEVKVSGNLDAPEGGFDAIMQAIVCQKEIGWRNQSRKMLLFSTDASF
HYAGDGKLGGIVTPNDGQCHLNAQNEYSESLNQDYPSISQLAQKISEKKVTVIFAVTSTQ
ARNYYFYKTLSEFIEGATVGALAEDSSNIVSLVRDNYNKISSSVELKTKGEEDTQVIIKS
KCFGSVLCDTAKCDDIRIGSNVTFDVTLMVTSCPKDKSKWKRTFSIYSVGFSEEVVVDVE
LMCSCNCEGPDQEVQRSEECSREGTLSCGTCLCNKGFYGKNCECSSDEMGTDDNLCKKSG
TSTSKICSGHGQCICGKCECNPINPSDPSKKYSGSYCDCNNYNCDYEDGKLCGGPERGVC
VCGSCKCNEGFQGASCGCATSKKECIASDGSECNNKGYCDCGRCRCTDVTYKGKTCEECP
TCPTACDEKRGCVLCRAFKVYSKLNEEECSKQCDHVAVVQEIDKIDETVGQWRYCKFRDD
SDGCDVQFKWNADNNEIKVAKSKGDVICPTPVNLLWIILPVIIGILVIGLLLLLIWKLLV
TLHDRREYARFEKERENAKWEMGENPIYKQATSTYKNPTY
Download sequence
Identical sequences T1EIY7
XP_009011632.1.102002 jgi|Helro1|139427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]