SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|156123 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|156123
Domain Number 1 Region: 312-478
Classification Level Classification E-value
Superfamily TPR-like 4.55e-22
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Domain Number 2 Region: 208-323
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000518
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|156123
Sequence length 498
Sequence
MDPFFLAVSNFRRRKFVHCVDICTDILKKNPYDQATWALKMQGLTEQVYVDEIDMEDESM
ADILMDDNAIANVSRPGTSLKRPNSQMGTSQGVRPMTNSGRPVTGFVRPGTQSGKSNSLD
QALKTPRTARTARPVSSATSRFVRLGTASMLTSADGPFINLSRLDFQKYASKLNVSKSLF
EYIFHHENDVKNALELASLATKASSFKDWWWKVQIGKCYHRLGLYRDAERQFQSALTSQP
IIDTYLYLAKVYIKIDQPLSALQTLKLGLEVYSNDLSLLIGQARIFEGLNENEKSLACYK
AVLNEDNMCVEAIACIGTNHFYSDQPEIALKFFRRLLQMGVCNAEIYNNIGLCCFHAQQY
DITVTCFQRALLLSDSQSSGDVWYNIGHVALSIGDLNLASRCFHLSLAENNDHAESYNNL
GVIEFMKGHTELSKAFLQASFNLSSAHFEPYYNYALLANKLGDLQTSYNSIRKSLQISSC
HNESISLHKSLQHHFIMI
Download sequence
Identical sequences T1ELR8
jgi|Helro1|156123 XP_009030374.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]