SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|159027 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|159027
Domain Number 1 Region: 51-215
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000165
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|159027
Sequence length 244
Sequence
MIQKYSPQSCVHVMHASYSNECNDVMLSIFVLCSHLCGWHSIPSSGALIEFVPGRSYEYL
YQTQVKLDDKSRHQQTNKYKASGYKAYTKFKVASIWSSENLHEHIIKLSASDKPHGNLPP
QDKHFESILKSPSYFHWNNGLVQYIYTHVTPSGELNMLKSLIDTFQLHSVLETQKFIQFA
DIRGQCNVTLSMDDNNELTANKTCINRSYLQRSTSYYLLGLLCLACPLQHFLTKERWPSS
NAVF
Download sequence
Identical sequences T1ENH9
XP_009009205.1.102002 jgi|Helro1|159027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]