SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169705 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|169705
Domain Number 1 Region: 134-203,231-264
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-16
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 2 Region: 45-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000599
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 3 Region: 264-324
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000891
Family Third domain of FERM 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169705
Sequence length 1110
Sequence
MVMCYNNIDTKNNNLDDDDDVIVATPSTTATSSLSKGLCHKKTIKCTVKLLDDSEMEIIM
KKSSKGQALINRIYKYLQINSGCGPHDNEPCYFSCTYFDSTTDKYVWLIHDKQISQQIKS
QPCYLKFKVKYYPDSPHEIKNEVIKNLMYQQIVKDVSEGRVSCSFATQSLLLSYQAQIEY
GDWDFPTSKFPECLKMSPDWKNRMGDYELDAYENVKKLEIPKKFDSLKFELWSKVFDLYK
VHRGQSREEATNNYLSNVSKVARYGMHTCYVENEGGNPVELCLCWLGLSVYDCSGEIRTT
KLTWPRLLKIAYKRNKFIILYRQNGVCDDGDDGGGGGGSCGKDCASFVSNDAKRQQLSID
EQLLHQTSNNLNGEDVDHNLQQHQQPHSFNNNFRNNSNNLKSSTKRSNSCKNSDNYSNKN
IYNVVGRSTSFNNNTYSCKSVSATKSNDDYFGICNNMTERAKISSVDNLRRNVYRTGKIV
LPYQQQQLQSQPHQLQPQQQLQPHQQQPQLRLHQQLQQLHQQHWPQQFQQECITQHENIP
HEIQNEFRQNLSHQQTLQPEHFKCVPMEYKQQYPPHENKTWPKKQQHCQKNLQLLNYQQQ
QHQLQAEQQQCLQRNDAHCRHQRLTEPPQAQTKTDFLKLQQHQQQQQQQYDGNLLDCQTS
THSTGKNGLPRLLQHPFHDKIQQFHRPQPQMYQDQVQQCQQQKYQEQREQAFYKNRTCAS
GRHQQHFNIQQQQQQHLYVEDQRGPAQQYQQHQQQRHQLQSQQQNEQQLQSLHSRPPLPP
SLQLKPRPKSGNTQLESRNIQQSSSTTTKATTPSINRKKENPYEFDRKSTRGNPKSPKEL
SKDIKGRKNIVITAYLDNNSLLSEPGGIYDNIVEADSINNINTNINNNNNTTRNNKNNNF
TQLSSKSYNNNNINNNNNNDSYGSYDNLYNYRTRTNHANMNDYYYDSHSYLQYCRRQNQQ
HHYQHQQQQLLLSPPQQLLLQQQQQQQSYDNNDDSNGEYDNLLQPCASSSSSFPYAPSTS
FPLQYQQSSSIPPLQTLTSSPRHVFFESPGGFKITQVRNPEDDSLIETVIEKTLIIEDKC
DEEEAIANAISSLTRIHPKLSVEEIEIKRK
Download sequence
Identical sequences T1F290
jgi|Helro1|169705 XP_009013776.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]